[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:murE"

murE        "UDP-N-acetylmuramoylalanyl-D-glutamate-2, 6-diaminopimelate ligase"
MURE_BACSU  "RecName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase;         EC=6.3.2.13;AltName: Full=UDP-MurNAc-L-Ala-D-Glu:meso-diaminopimelate ligase;AltName: Full=Meso-diaminopimelate-adding enzyme;AltName: Full=Meso-A2pm-adding enzyme;AltName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;AltName: Full=UDP-MurNAc-tripeptide synthetase;"

OrgPattern --------------------------------211---------------------------1----- 1433321122221111111-11111111111211111122211222122112212111222223112213223332221232233322221233114--534333313231111111111111121221324334411122---3233323333222222322313311132222223232332111132253344747467447644544333465533354543333432334444444444444444443334311333333322113344333224444222233222222222224444443444444244222444427644333333343453442575144433432454433547326644132241422223333222222122212144344434443-111111112323333333324322114423322222322222222221112132222------11224444444444444424313132432221111111122221122222222112243333322111224334323422353344454443445132442242322231213232332322221212321111111111111111121111111332222225332232222312222232422322-42312-3-21222122222222222222-22222222222222222221112222211111111111111112222222222222222222222222322222444312121222323211123333444444421222222222222222222226655465562222222222222222233333333222243221111111111111111--------------------------2631122232213 -------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------1-1119111114122-13------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLTKLLTYLTTEPSVNDSQDPEITSIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVEN:Sequence : ccccccccEccGGGccTTcEEEEcccccccGGGGHHHHHHT:Sec Str : XXXXXXXXXXX :SEG|2->12|kltklltyltt : ========================================:RP:SCP|21->97|1gg4A3|6e-25|33.8|77/98|c.98.1.1 : ================================================:BL:SWS|13->494|MURE_BACSU|0.0|100.0|482/494 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->88|PF01225|2e-09|46.8|62/76|Mur_ligase 61: . . . * . .: 120 :GAAAIVAEREVDVNVPVIIVRQSLRALSVLSDAFYGQPTKKLQLIGITGTNGKTSTTHMV:Sequence :TccEEEEEcEEETTEEEEEETTHHHHHHHHHHHHTTcGGGccEEEEEEccccHHHHHHHH:Sec Str :===================================== :RP:SCP|21->97|1gg4A3|6e-25|33.8|77/98|c.98.1.1 : =======================:RP:SCP|98->330|1e8cA3|4e-56|31.4|226/234|c.72.2.1 :============================================================:BL:SWS|13->494|MURE_BACSU|0.0|100.0|482/494 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|27->88|PF01225|2e-09|46.8|62/76|Mur_ligase : $$$$$$$$$$$$$$:RP:PFM|107->311|PF08245|5e-27|41.3|184/187|Mur_ligase_M 121: . . + . . .: 180 :DEILKKAGKRTGLIGTMYMKIGDETLPVKNTTPESVTLQKTFKKMNDKHVDTAIMEVSSH:Sequence :HHHHHHTTccEcTTccEETTccTcTcccccccccHHHHHHHHHHHHHTTTccEEEEccHH:Sec Str :============================================================:RP:SCP|98->330|1e8cA3|4e-56|31.4|226/234|c.72.2.1 :============================================================:BL:SWS|13->494|MURE_BACSU|0.0|100.0|482/494 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|107->311|PF08245|5e-27|41.3|184/187|Mur_ligase_M 181: . * . . . .: 240 :ALSLGRVHGCDYDIAVFTNLTQDHLDYHKTMDEYRHAKSLLFSQLGGAFNHEHPKRAVLN:Sequence :HHHTTTTTTccccEEEEcccccccHHHHccHHHHHHHHHHHcTGGGcccTcccccEEEEE:Sec Str :============================================================:RP:SCP|98->330|1e8cA3|4e-56|31.4|226/234|c.72.2.1 :============================================================:BL:SWS|13->494|MURE_BACSU|0.0|100.0|482/494 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|107->311|PF08245|5e-27|41.3|184/187|Mur_ligase_M 241: + . . . . *: 300 :ADDEASAYFEKVTAAHISTYGIKNDADVMAKNISITAQGTSFDLVTNKGTKHITMSLVGQ:Sequence :TTcHHHHHHHTTcTTcEEEEcccccEEEEEEEEEEccccEEEEEEEETTccEEEEEcccH:Sec Str :============================================================:RP:SCP|98->330|1e8cA3|4e-56|31.4|226/234|c.72.2.1 :============================================================:BL:SWS|13->494|MURE_BACSU|0.0|100.0|482/494 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|107->311|PF08245|5e-27|41.3|184/187|Mur_ligase_M 301: . . . . + .: 360 :FNVYNVLAAVATCIAAGIPFEIITEAVEELHGVRGRFELVNQQQEFPVIVDYAHTPDSLE:Sequence :HHHHHHHHHHHHHHHTTccHHHHHHHGGGccccTTcEEEccTTcTcEEEEEccccHHHHH:Sec Str :============================== :RP:SCP|98->330|1e8cA3|4e-56|31.4|226/234|c.72.2.1 : ============================:RP:SCP|333->489|1e8cA2|6e-33|46.5|157/160|c.59.1.1 :============================================================:BL:SWS|13->494|MURE_BACSU|0.0|100.0|482/494 :$$$$$$$$$$$ :RP:PFM|107->311|PF08245|5e-27|41.3|184/187|Mur_ligase_M : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|335->408|PF02875|8e-16|47.3|74/84|Mur_ligase_C 361: . . . * . .: 420 :NVLETCRDMTEGKLFVVVGCGGDRDKTKRPKMAKIAVELADEPIFTSDNPRSEDPRAILR:Sequence :HHHHHHHHTccccEEEEEccccccccTHHHHHHHHHHHHccEEEEccccccTccHHHHHH:Sec Str :============================================================:RP:SCP|333->489|1e8cA2|6e-33|46.5|157/160|c.59.1.1 :============================================================:BL:SWS|13->494|MURE_BACSU|0.0|100.0|482/494 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|335->408|PF02875|8e-16|47.3|74/84|Mur_ligase_C 421: . . + . . .: 480 :DMEAGVENAYYHSIANREQAIFFAIANAKKGDVVLIAGKGHETYQQIGNETFDFDDAEVA:Sequence :HHHTTccTTccEcEccHHHHHHHHHHHccTTcEEEEEccTTccEEEETTEEEEccHHHHH:Sec Str :============================================================:RP:SCP|333->489|1e8cA2|6e-33|46.5|157/160|c.59.1.1 :============================================================:BL:SWS|13->494|MURE_BACSU|0.0|100.0|482/494 481: . * . . . .: 540 :ARAIVELNKNKTNS :Sequence :HHHHTcccTTc :Sec Str :========= :RP:SCP|333->489|1e8cA2|6e-33|46.5|157/160|c.59.1.1 :============== :BL:SWS|13->494|MURE_BACSU|0.0|100.0|482/494