[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:nrdE"

nrdE        "ribonucleoside-diphosphate reductase (major subunit)"
RIR1_BACSU  "RecName: Full=Ribonucleoside-diphosphate reductase subunit alpha;         EC=1.17.4.1;AltName: Full=Ribonucleotide reductase large subunit;"

OrgPattern 11---11111111111-11111111111-222--1--------1111-1-111-11111111111-11 11--221111111111122-211112222221222211112--1111211111211111122122122222-111111--1-11122112111-111--21212221221111111111111111---1-------111--32312111-111----------11-------------------111111-111112221122222112111112212121111111111112111111111111111113111-1-11-2-1-11111111111111122221221111111111111122222222222221111111111---1111-111111112--1111111112---111--1-1111111-111231211211111-11--111-1---11111111111---------2131111111-111---1111--21111-2-11111111211111221111111111111111111111111111111111111111111111111111122111111122222211211122222133121111222221111111111111211-111111-1111111121211112111211111111111111111111111111112211211111111111111111111111111-1121111-11122121222222222222-222222222222222222222222222222222222213222222222222112223222332221111111111111112212221211111-111111111111112111211111111111111111111111121121111111211221111111111111111---------1--1-11111111---11-11111-11111---1-111111111-1 1111111-311-1111111111111111121111111111111111111111111111111122222212122222212222222211-111111111111114231131123222111111111-111291-112111111111111-11112111111643111-111111221111H1111121241112241115 ---1-1-1--------1--1-1-11------------1-1--------------------------------------------------------------------------------------1---------------------------------1---1-----1111-

Master   AminoSeq   


1: . . . . + .: 60 :MSQNQVPKWIQLNNEIMIQKDGKFQFDKDKEAVHSYFVDYINQNTVFFHNLKEKLDYLVE:Sequence : ccHHHHHHGGGcccccccccTHHHHHHHHHHHHTTGGGccccccHHHHHHHHHH:Sec Str : XXXXXXXXXXXX :SEG|19->30|qkdgkfqfdkdk : ======================================================:RP:SCP|7->166|1pemA1|3e-39|35.0|160/162|a.98.1.1 :============================================================:BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->89|PF08343|2e-15|50.0|78/81|RNR_N 61: . . . * . .: 120 :NQYYEEEFLSLYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYED:Sequence :TTcccHHHHTTccHHHHHHHHHHHHHTccccccHHHHHHHHHHTccccTTcccccccHHH:Sec Str :============================================================:RP:SCP|7->166|1pemA1|3e-39|35.0|160/162|a.98.1.1 :============================================================:BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|12->89|PF08343|2e-15|50.0|78/81|RNR_N : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|94->164|PF00317|9e-08|40.0|70/80|Ribonuc_red_lgN 121: . . + . . .: 180 :RISIVALFFANGDTEKAKEYVNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLN:Sequence :HHHHHHHHHHTTcHHHHHHHHHHHHTTcEEEcHHHHTTcccccccccccEEEEEccccHH:Sec Str :============================================== :RP:SCP|7->166|1pemA1|3e-39|35.0|160/162|a.98.1.1 : ==============:RP:SCP|167->689|1pemA2|e-133|46.7|516/520|c.7.1.2 :============================================================:BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|94->164|PF00317|9e-08|40.0|70/80|Ribonuc_red_lgN : $$$$$$$$$$$$:RP:PFM|169->684|PF02867|1e-81|38.3|483/506|Ribonuc_red_lgC 181: . * . . . .: 240 :DISRAIDISMQLSKLGGGVSLNLSKLRAKGEAIKDVENATKGVVGVMKLLDNAFRYADQM:Sequence :HHHHHHHHHHHHHTTTcEEEEEcTTcccTTcccTTccccccccHHHHHHHHHHHHHcTTT:Sec Str :============================================================:RP:SCP|167->689|1pemA2|e-133|46.7|516/520|c.7.1.2 :============================================================:BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->684|PF02867|1e-81|38.3|483/506|Ribonuc_red_lgC 241: + . . . . *: 300 :GQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSIGVVIPDKFVELAREDKAAYV:Sequence :TcccccEEEEEETTcTTHHHHTTccccccccTTcccccEEEEEccTHHHHHHHTccEEEE:Sec Str :============================================================:RP:SCP|167->689|1pemA2|e-133|46.7|516/520|c.7.1.2 :============================================================:BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->684|PF02867|1e-81|38.3|483/506|Ribonuc_red_lgC 301: . . . . + .: 360 :FYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLRSESGYPYIMF:Sequence :EcHHHHHHHHcccGGGccccTTHHHHHHcccccEEEEEHHHHHHHHHHHHHHHcccEEEc:Sec Str :============================================================:RP:SCP|167->689|1pemA2|e-133|46.7|516/520|c.7.1.2 :============================================================:BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->684|PF02867|1e-81|38.3|483/506|Ribonuc_red_lgC 361: . . . * . .: 420 :QDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVM:Sequence :HHHHHHTcHcccccccccccTTccccccccccEEcTTccEEEccccEEccEEEEcHHHHH:Sec Str :============================================================:RP:SCP|167->689|1pemA2|e-133|46.7|516/520|c.7.1.2 :============================================================:BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->684|PF02867|1e-81|38.3|483/506|Ribonuc_red_lgC 421: . . + . . .: 480 :EHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYE:Sequence :HcccHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHcccEEccccHHHHHHHTTccTT:Sec Str :============================================================:RP:SCP|167->689|1pemA2|e-133|46.7|516/520|c.7.1.2 :============================================================:BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->684|PF02867|1e-81|38.3|483/506|Ribonuc_red_lgC 481: . * . . . .: 540 :SPEARDFANTFFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKY:Sequence :cHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccGGGcHHHHTTTTTTTccccccccc:Sec Str :============================================================:RP:SCP|167->689|1pemA2|e-133|46.7|516/520|c.7.1.2 :============================================================:BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->684|PF02867|1e-81|38.3|483/506|Ribonuc_red_lgC 541: + . . . . *: 600 :EKIANLFEGMHIPTTEDWKKLKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMER:Sequence :HHHHHHHHTcccccTTHHHHHHHHHHHHcccccccccccccccGGGTTTccccccccccc:Sec Str : ####################### :PROS|558->580|PS00089|RIBORED_LARGE|PDOC00084| :============================================================:RP:SCP|167->689|1pemA2|e-133|46.7|516/520|c.7.1.2 :============================================================:BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->684|PF02867|1e-81|38.3|483/506|Ribonuc_red_lgC 601: . . . . + .: 660 :IEERTYGNSKTYYPMPGLASNNWFFYKEAYDMDMFKVVDMIATIQQHIDQGISFTLFLKD:Sequence :EEEEccTTTcEEEEcTTcccccGGGcccHHHHcHHHHHHHHHHHHHHccccccccEEEcT:Sec Str :============================================================:RP:SCP|167->689|1pemA2|e-133|46.7|516/520|c.7.1.2 :============================================================:BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->684|PF02867|1e-81|38.3|483/506|Ribonuc_red_lgC 661: . . . * . .: 720 :TMTTRDLNRIDLYAHHRGIKTIYYARTKDTGQDSCLSCVV :Sequence :TccHHHHHHHHHHHHHHTccEEccEEEcccHHH :Sec Str :============================= :RP:SCP|167->689|1pemA2|e-133|46.7|516/520|c.7.1.2 :======================================== :BL:SWS|1->700|RIR1_BACSU|0.0|100.0|700/700 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|169->684|PF02867|1e-81|38.3|483/506|Ribonuc_red_lgC