[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:ureC"

ureC        "urease (alpha subunit)"
URE1_BACSU  "RecName: Full=Urease subunit alpha;         EC=3.5.1.5;AltName: Full=Urea amidohydrolase subunit alpha;"

OrgPattern ------1--------1--------1---1--1----------------------------------1- ----1--1111-111--11-12--1211111111111211-1111-1-----11111-------1-3223-----1----------------1--------1---11-------------------------------------111-11--111--1111-1111-111111-11111-1-1--1-------1------1---------1---1----1-1----------1-11111111111111111-1---------------------------------------------------------------111---------------------------1-11-------------------1---------------11133---1111122222222222-3413313211--111111111111111--111111111111111111----1---------------------------------------111-1111111111111211111111111111-1111111--111111-11-1-1-1---------1-11--------------------------11-1--1----------211111111---------1111---11-------1--------------11-1------1---11--12--------1---------1--------111--111--------------------------11111111111111------------1111111----1111----1121111-2-1-11111111111111112-----------11---------------------------1----------------------------------------111-----------1- -------------2111111121111111111111111111111111111211211111111------------------------11-12111211111121221--2-3----------------------------------------------------21--------2-----8111--1-111111111113 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRI:Sequence :HcccHHHHHHHHcccTTcEEEcTTcccEEEccEEcccTTccccccTTcccccTTTccccc:Sec Str : ===========================================================:RP:SCP|2->145|1a5kC1|7e-34|57.1|140/181|b.92.1.1 :============================================================:BL:SWS|1->569|URE1_BACSU|0.0|100.0|569/569 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->122|PF00449|2e-42|72.0|118/119|Urease_alpha 61: . . . * . .: 120 :TGKDGALDLVITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTE:Sequence :ccGGGcccEEEEEEEEEETTEEEEEEEEEETTEEEEEEcEEcTTTcccccGcEEccTTcE:Sec Str :============================================================:RP:SCP|2->145|1a5kC1|7e-34|57.1|140/181|b.92.1.1 :============================================================:BL:SWS|1->569|URE1_BACSU|0.0|100.0|569/569 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->122|PF00449|2e-42|72.0|118/119|Urease_alpha 121: . . + . . .: 180 :VISGEGKILTAGGVDTHIHFICPQQMEVALSSGVTTLLGGGTGPATGSKATTCTSGAWYM:Sequence :EEEcTTcEEEEcEEEEEEEcccTHHHHHHHHHTEEEEEEEcccccHHHHHcccccHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|149->172|alssgvttllgggtgpatgskatt : ############## :PROS|130->143|PS01120|UREASE_1|PDOC00133| :========================= :RP:SCP|2->145|1a5kC1|7e-34|57.1|140/181|b.92.1.1 : ================================================:RP:SCP|133->569|1a5kC2|e-110|59.1|384/385|c.1.9.2 :============================================================:BL:SWS|1->569|URE1_BACSU|0.0|100.0|569/569 :$$ :RP:PFM|2->122|PF00449|2e-42|72.0|118/119|Urease_alpha 181: . * . . . .: 240 :ARMLEAAEEFPINVGFLGKGNASDKAPLIEQVEAGAIGLKLHEDWGTTPSAIKTCMEVVD:Sequence :HHHHHHHTTcccEEEEEEEcccccHHHHHHHHHHTccEEEEcGGGcccHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|133->569|1a5kC2|e-110|59.1|384/385|c.1.9.2 :============================================================:BL:SWS|1->569|URE1_BACSU|0.0|100.0|569/569 : $$$$$$$$$$$$:RP:PFM|229->305|PF04452|6e-05|28.4|74/225|Methyltrans_RNA 241: + . . . . *: 300 :EADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAGGGHAPDIMKLASYANILPSS:Sequence :HHTcEEEEcccTTcccccHHHHHHHHTTccEEETTTTcTTcccTTTGGGGGGcTTEEEEE:Sec Str :============================================================:RP:SCP|133->569|1a5kC2|e-110|59.1|384/385|c.1.9.2 :============================================================:BL:SWS|1->569|URE1_BACSU|0.0|100.0|569/569 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|229->305|PF04452|6e-05|28.4|74/225|Methyltrans_RNA 301: . . . . + .: 360 :TTPTIPYTVNTMDEHLDMMMVCHHLDAKVPEDVAFSHSRIRAATIAAEDILHDIGAISMT:Sequence :EcTTccccTTHHHHHHHHHHHHHTccTTcHHHHHHHHTTccHHHHHHHHHHHHTTcccEE:Sec Str : ################# :PROS|320->336|PS00145|UREASE_2|PDOC00133| :============================================================:RP:SCP|133->569|1a5kC2|e-110|59.1|384/385|c.1.9.2 :============================================================:BL:SWS|1->569|URE1_BACSU|0.0|100.0|569/569 :$$$$$ :RP:PFM|229->305|PF04452|6e-05|28.4|74/225|Methyltrans_RNA 361: . . . * . .: 420 :SSDSQAMGRVGEVIIRTWQVADKMKKQRGALAGENGNDNVRAKRYIAKYTINPAITHGLS:Sequence :EccTTccccTTcHHHHHHHHHHHHHHHHcccTTcccccHHHHHHHHHTTTHHHHHHTTcT:Sec Str :============================================================:RP:SCP|133->569|1a5kC2|e-110|59.1|384/385|c.1.9.2 :============================================================:BL:SWS|1->569|URE1_BACSU|0.0|100.0|569/569 : $$$$$$$$$$$:RP:PFM|410->438|PF01979|5e-04|58.6|29/271|Amidohydro_1 421: . . + . . .: 480 :HEVGSVEKGKLADLVLWDPVFFGVKPELVLKGGMIARAQMGDPNASIPTPEPVFMRQMYA:Sequence :TTcccccTTccccEEEEcGGGTTTcccEEEETTEEEEEEEccTTcccccccccEEEEcGG:Sec Str :============================================================:RP:SCP|133->569|1a5kC2|e-110|59.1|384/385|c.1.9.2 :============================================================:BL:SWS|1->569|URE1_BACSU|0.0|100.0|569/569 :$$$$$$$$$$$$$$$$$$ :RP:PFM|410->438|PF01979|5e-04|58.6|29/271|Amidohydro_1 481: . * . . . .: 540 :SYGKANRSTSITFMSQASIERGVAESLGLEKRISPVKNIRKLSKLDMKLNSALPKIEIDP:Sequence :GcHHHHHHHcEEEEcHHHHHTTHHHHHTcccEEEEcccTTTccGGGcTTccccccEEEcT:Sec Str :============================================================:RP:SCP|133->569|1a5kC2|e-110|59.1|384/385|c.1.9.2 :============================================================:BL:SWS|1->569|URE1_BACSU|0.0|100.0|569/569 541: + . . . . *: 600 :KTYQVFADGEELSCQPVDYVPLGQRYFLF :Sequence :TTccEEETTEEccccccccccccTTTccc :Sec Str :============================= :RP:SCP|133->569|1a5kC2|e-110|59.1|384/385|c.1.9.2 :============================= :BL:SWS|1->569|URE1_BACSU|0.0|100.0|569/569