[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAB15681.1 bsub0 ureC "urease (alpha subunit)"
MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRI
TGKDGALDLVITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTE
VISGEGKILTAGGVDTHIHFICPQQMEVALSSGVTTLLGGGTGPATGSKATTCTSGAWYM
ARMLEAAEEFPINVGFLGKGNASDKAPLIEQVEAGAIGLKLHEDWGTTPSAIKTCMEVVD
EADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAGGGHAPDIMKLASYANILPSS
TTPTIPYTVNTMDEHLDMMMVCHHLDAKVPEDVAFSHSRIRAATIAAEDILHDIGAISMT
SSDSQAMGRVGEVIIRTWQVADKMKKQRGALAGENGNDNVRAKRYIAKYTINPAITHGLS
HEVGSVEKGKLADLVLWDPVFFGVKPELVLKGGMIARAQMGDPNASIPTPEPVFMRQMYA
SYGKANRSTSITFMSQASIERGVAESLGLEKRISPVKNIRKLSKLDMKLNSALPKIEIDP
KTYQVFADGEELSCQPVDYVPLGQRYFLF
//