[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:ybbR"

ybbR        "conserved hypothetical protein"
YBBR_BACSU  "RecName: Full=YbbR-like domain-containing protein ybbR;Flags: Precursor;"

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111111-1111111111111111111-111111111111111111111111111111111111111111111111111111111111111--111111111-11--11-111-1-111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDKFLNNRWAVKIIALLFALLLYVAVNSNQAPTPKKPGESFFPTSTTDEATLTDIPVKAY:Sequence : XXXXXXXXXX :SEG|13->22|iiallfalll :============================================================:BL:SWS|1->410|YBBR_BACSU|0.0|100.0|410/483 61: . . . * . .: 120 :YDDENYVVTGVPQTVNVTIKGSTSAVKKARQTKNFEIYADMEHLKTGTHKVELKAKNVSD:Sequence :============================================================:BL:SWS|1->410|YBBR_BACSU|0.0|100.0|410/483 121: . . + . . .: 180 :GLTISINPSVTTVTIQERTTKSFPVEVEYYNKSKMKKGYSPEQPIVSPKNVQITGSKNVI:Sequence :============================================================:BL:SWS|1->410|YBBR_BACSU|0.0|100.0|410/483 181: . * . . . .: 240 :DNISLVKASVNLENADETIEKEAKVTVYDKDGNALPVDVEPSVIKITVPVTSPSKKVPFK:Sequence :============================================================:BL:SWS|1->410|YBBR_BACSU|0.0|100.0|410/483 : $$$$:RP:PFM|237->312|PF07949|1e-07|34.2|76/81|YbbR 241: + . . . . *: 300 :IERTGSLPDGVSIANIESSPSEVTVYGSQDVLDSLEFIDGVSLDLSKINKDSDIEADIPL:Sequence :============================================================:BL:SWS|1->410|YBBR_BACSU|0.0|100.0|410/483 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|237->312|PF07949|1e-07|34.2|76/81|YbbR 301: . . . . + .: 360 :PDGVKKISPSKVTLHIEVDSEADQKFENVPIKTVGLSSSQNIEFLDPESQAIDVTAKGSP:Sequence :============================================================:BL:SWS|1->410|YBBR_BACSU|0.0|100.0|410/483 :$$$$$$$$$$$$ :RP:PFM|237->312|PF07949|1e-07|34.2|76/81|YbbR 361: . . . * . .: 420 :TNINKLKKSDIELYVNVSDLEDGEHSVKLEVNGPQNVTWSLGRKNAKIKLTSKKSNTSTN:Sequence : XXXXXXXXXX:SEG|411->473|tskksntstndnssntsgnqdtdkqtndqknnqqedtkntdknnndqnqdgnkdqnqdqdede :================================================== :BL:SWS|1->410|YBBR_BACSU|0.0|100.0|410/483 421: . . + . . .: 480 :DNSSNTSGNQDTDKQTNDQKNNQQEDTKNTDKNNNDQNQDGNKDQNQDQDEDESTANSQS:Sequence :XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|411->473|tskksntstndnssntsgnqdtdkqtndqknnqqedtkntdknnndqnqdgnkdqnqdqdede 481: . * . . . .: 540 :SSE :Sequence