[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAB11952.2 bsub0 ybbR "conserved hypothetical protein"
MDKFLNNRWAVKIIALLFALLLYVAVNSNQAPTPKKPGESFFPTSTTDEATLTDIPVKAY
YDDENYVVTGVPQTVNVTIKGSTSAVKKARQTKNFEIYADMEHLKTGTHKVELKAKNVSD
GLTISINPSVTTVTIQERTTKSFPVEVEYYNKSKMKKGYSPEQPIVSPKNVQITGSKNVI
DNISLVKASVNLENADETIEKEAKVTVYDKDGNALPVDVEPSVIKITVPVTSPSKKVPFK
IERTGSLPDGVSIANIESSPSEVTVYGSQDVLDSLEFIDGVSLDLSKINKDSDIEADIPL
PDGVKKISPSKVTLHIEVDSEADQKFENVPIKTVGLSSSQNIEFLDPESQAIDVTAKGSP
TNINKLKKSDIELYVNVSDLEDGEHSVKLEVNGPQNVTWSLGRKNAKIKLTSKKSNTSTN
DNSSNTSGNQDTDKQTNDQKNNQQEDTKNTDKNNNDQNQDGNKDQNQDQDEDESTANSQS
SSE
//