[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:ydaM"

ydaM        "putative glycosyltransferase associated to biofilm formation"
YDAM_BACSU  "RecName: Full=Uncharacterized glycosyltransferase ydaM;         EC=2.4.-.-;"

OrgPattern --1-1-234333233322--1--1---1--1-2-21---------1-2-1133-34234141--2-22 35121--1111----------1----------1333-2-11-1-11--1--22411-----11--1-23221111111--1--1--2-3222-5-----31315253121--------------1--1-2-2313-2---1---1342552243233212332112343412121122111111---112-2111-3-22123242244122231322-11211-11111152111111111111111--111142-----1-13322221121-13231---222-11------------------------1----1---121162333333324222331211143--12-1-111212--12---13--3122--------321--1--2-11211111111111-54454321123-244154332432321-31111211121--------211--3------------11--11--1------1-11--11-12111-2222231222122-33333-212-1312-21111---1-1--1--11----2--------11------4-1-21-2--111123-1232-553532132--------1----------2--2----2211-1--1--1-1-----11--1-----------1------1111-212223233332-232221123222-33233333333-33111-1111111111--1121--11-1211111-11111---2---------1-1--111111---------32333-2---11----112211-1-21-------1----3232------21--1121211111------2-112211---1--1--------------1------2-------21142-1---211 ---------------21-1----1-1--------------------33---11-11-1-111------------------------------1---------2-----1-------------------------------------------------1--------------2--1-1811113A66B2E3------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---

Master   AminoSeq   


1: . . . . + .: 60 :MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNE:Sequence : HHHHTccTTcEEccccccHHHHHHHETTTccEEEEEEEccc:Sec Str : ================================:RP:SCP|29->300|1xhbA2|1e-24|17.3|271/316|c.68.1.17 :============================================================:BL:SWS|1->420|YDAM_BACSU|0.0|100.0|420/420 : $$$$$$$$$:RP:PFM|52->184|PF00535|1e-13|36.2|127/148|Glycos_transf_2 61: . . . * . .: 120 :EVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGK:Sequence :TTTHHHHHHTTGGGcTTTcEcEEEEEEccccccHHHHHHHTTcEEEEHHHHcTTcccccc:Sec Str :============================================================:RP:SCP|29->300|1xhbA2|1e-24|17.3|271/316|c.68.1.17 :============================================================:BL:SWS|1->420|YDAM_BACSU|0.0|100.0|420/420 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->184|PF00535|1e-13|36.2|127/148|Glycos_transf_2 121: . . + . . .: 180 :GKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKT:Sequence :cHHHHHHHHHHHccccEEEEcccccccccTTHHHHHcHHHHHcccccEEEEEEcccHHHH:Sec Str :============================================================:RP:SCP|29->300|1xhbA2|1e-24|17.3|271/316|c.68.1.17 :============================================================:BL:SWS|1->420|YDAM_BACSU|0.0|100.0|420/420 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->184|PF00535|1e-13|36.2|127/148|Glycos_transf_2 181: . * . . . .: 240 :LLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSIIEKLGGWDDKALAEDTELT:Sequence :HTEEcccHHHHTHHHHHHHHcGGGTTcccTTcccEEEEHHHHHHcccccGccGGHHHHHH:Sec Str :============================================================:RP:SCP|29->300|1xhbA2|1e-24|17.3|271/316|c.68.1.17 :============================================================:BL:SWS|1->420|YDAM_BACSU|0.0|100.0|420/420 :$$$$ :RP:PFM|52->184|PF00535|1e-13|36.2|127/148|Glycos_transf_2 241: + . . . . *: 300 :IRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQYVVLKFLAQFFKLKRKRII:Sequence :HHHHHHHcTTcEEEEEccccccccHHHHHHHHHHHHHHHHTTccccccccEEccccEEc :Sec Str :============================================================:RP:SCP|29->300|1xhbA2|1e-24|17.3|271/316|c.68.1.17 :============================================================:BL:SWS|1->420|YDAM_BACSU|0.0|100.0|420/420 301: . . . . + .: 360 :FDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFLFMTEVMITLS:Sequence : :Sec Str :XXXXXXXXXXXXXXX :SEG|301->315|fdlfyffftyflfff :============================================================:BL:SWS|1->420|YDAM_BACSU|0.0|100.0|420/420 361: . . . * . .: 420 :IEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKHRLFKQEVKWYKTERYNQHKSG:Sequence : :Sec Str :============================================================:BL:SWS|1->420|YDAM_BACSU|0.0|100.0|420/420