[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:yfjB"

yfjB        "hypothetical protein"
YFJB_BACSU  "RecName: Full=Uncharacterized protein yfjB;"

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSGNIAVDPDKLEQLANDVVTELTDMENKYKDLHVELGQMILQCDPRYSSCFSGVGDAWS:Sequence :============================================================:BL:SWS|1->407|YFJB_BACSU|0.0|100.0|407/407 61: . . . * . .: 120 :SGKALVTKLSDNEIFIRKTGDKFVEQDDILRKLYNAYDKYGTMTSLTALMLTQGKYYGLG:Sequence :============================================================:BL:SWS|1->407|YFJB_BACSU|0.0|100.0|407/407 121: . . + . . .: 180 :LTKFVKQPSGLHTAQHSKLLLDISRAVDSSRYQKAARVLLNPKYLLKKTNRPFSDLVHKK:Sequence :============================================================:BL:SWS|1->407|YFJB_BACSU|0.0|100.0|407/407 181: . * . . . .: 240 :FTKYFPQDTVDFSNSVRSYTKGFLNEAGVRSTLKDVGKTGLRFAKGNAITATLITGATET:Sequence :============================================================:BL:SWS|1->407|YFJB_BACSU|0.0|100.0|407/407 241: + . . . . *: 300 :FGAGVKIAENYAKYQDKPEVLKRENAKAVGNAVNNTIFVAGGATAGAVIGGAIGSFAGPV:Sequence : XXXXXXXXXXXXXXXXXXXXXXX :SEG|276->298|tifvaggatagaviggaigsfag :============================================================:BL:SWS|1->407|YFJB_BACSU|0.0|100.0|407/407 301: . . . . + .: 360 :GTVLLGAAGSYIGGVVGEQIAKYTAGFAEKAALKLKEPIHAVVDTAKKGLESAGKVVKSV:Sequence :============================================================:BL:SWS|1->407|YFJB_BACSU|0.0|100.0|407/407 361: . . . * . .: 420 :NDGIDAANKSIHKGIDSAKKGMEKAKKTADSLIHGATHFLKGKFSFG :Sequence :=============================================== :BL:SWS|1->407|YFJB_BACSU|0.0|100.0|407/407