[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAB12645.1 bsub0 yfjB "hypothetical protein"
MSGNIAVDPDKLEQLANDVVTELTDMENKYKDLHVELGQMILQCDPRYSSCFSGVGDAWS
SGKALVTKLSDNEIFIRKTGDKFVEQDDILRKLYNAYDKYGTMTSLTALMLTQGKYYGLG
LTKFVKQPSGLHTAQHSKLLLDISRAVDSSRYQKAARVLLNPKYLLKKTNRPFSDLVHKK
FTKYFPQDTVDFSNSVRSYTKGFLNEAGVRSTLKDVGKTGLRFAKGNAITATLITGATET
FGAGVKIAENYAKYQDKPEVLKRENAKAVGNAVNNTIFVAGGATAGAVIGGAIGSFAGPV
GTVLLGAAGSYIGGVVGEQIAKYTAGFAEKAALKLKEPIHAVVDTAKKGLESAGKVVKSV
NDGIDAANKSIHKGIDSAKKGMEKAKKTADSLIHGATHFLKGKFSFG
//