[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:yjkB"

yjkB        "putative phosphate ABC transporter (ATP-binding protein)"
YJKB_BACSU  "RecName: Full=Putative ABC transporter ATP-binding protein yjkB;"

OrgPattern PPIENJKJSSROSOXMmGPNKQOYrNRhiTbQJDCEDAIHHGDUZRUlLR**f8VdTTXPSNJHV179 VbmM*cfgppsUZQaSWPO-OcBBZ*PPPPPRmnooy***T*S*t**hpmgO**yQXiCC**xh*q****ffZYY*cbdP*ekDBB9ASROK4KEIL--FFQJIKcMZNT8999999BBCCCCCGVSLTZQNVSaSfmnz*JJJ*ZziougfjabXYPDLGNFfhUi***VJQIKIJKPILIHaUUMKunBbfx************************gnw**loyxztwv**UhjkikfeghiihghYfZXX*pde**eQibpxxPQ**dXQVingfhnorytqy*xxuyuttouyqvtcddcacefgfebc*srggisrukn***********h*lr***Ymmk*ph*x*inPJ**slTWgpTXleolPcYVMdPQQMJKHGLbR***YSp****x***********-il*gd*j***T9**************JKM**********TTTTTTTTqVbJQiU*665566666589B9DF8BCB9ABBA86A6KECKCE***********rssto*****w*zcz*******AJuuq*jqkn*u****ZgkNUIRjRGHFFHGHPRQWgbcv*RgTnmUftYWjIaYWVTSgVYWYTYs*XzHLKLDKKLLJFBBCEDCDCCGREGHMLppvQrRXJTKrORWXSOUbVSTTVWYWWZY5-CJUMM321222*w**Y**z*******xy-*zyz*********vvywvx*****lrnpqpopqqpqpnlplon*uopuuuwT4************24IHDGDDELMOMMG*n*ZYWWYXJNPLKUNRZMOPOODPHLUldtvwu****u**x*f***EEECDFFDEMfpp*qrqrry****NQQNOONNOPGEFE67LWRQKLJK89788988*BZECDAF-D8GBHHCNPMCGMCHE669aioXTr*uqoDcK 1366hdK-kNDAYiSKLLHINSOYRXPIHBECFTOPELJJKJIEDCLILWVSeYKMPGFGGHJDD78C1BD6ACFAC2ACBBBCCC6A-RaDLLNHEEEGE7CMJF7Nhp*ZkZwkvOMKGNfQ**C*F**y4*a*PMPElGQ*cFQMHEhEB*LbYXtKs*OvThE*io*fiuZGKIE*AGBJOvhk*N**LN*l*wJ ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEANDQTQNIPAISFRSVRKSYKQDGQTYDVLQDVTGDIQQGAIVAVLGPSGSGKSTLLS:Sequence : ================================================:RP:SCP|13->247|1b0uA|8e-40|28.7|230/258|c.37.1.12 :============================================================:BL:SWS|1->250|YJKB_BACSU|e-141|100.0|250/250 : $$$$$:RP:PFM|56->173|PF00005|7e-07|36.6|112/123|ABC_tran 61: . . . * . .: 120 :MCNLMRTPDSGEVNIYGKEVREWNVNELRRTAALAFQSAPVLDGTVRDNLSLVQRLHQSQ:Sequence :============================================================:RP:SCP|13->247|1b0uA|8e-40|28.7|230/258|c.37.1.12 :============================================================:BL:SWS|1->250|YJKB_BACSU|e-141|100.0|250/250 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|56->173|PF00005|7e-07|36.6|112/123|ABC_tran 121: . . + . . .: 180 :LYSPEKLASLAGLPPELLDRSARDLSGGQRQRLSLARTLSNPSSILLLDEITSALDPVSA:Sequence : ############### :PROS|145->159|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|13->247|1b0uA|8e-40|28.7|230/258|c.37.1.12 :============================================================:BL:SWS|1->250|YJKB_BACSU|e-141|100.0|250/250 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|56->173|PF00005|7e-07|36.6|112/123|ABC_tran 181: . * . . . .: 240 :LEIEELIKRQHQEKKWTVMWVTHNMEQAKRIADTIWFMADGRLLEIAETDTFFSAPQHEA:Sequence :============================================================:RP:SCP|13->247|1b0uA|8e-40|28.7|230/258|c.37.1.12 :============================================================:BL:SWS|1->250|YJKB_BACSU|e-141|100.0|250/250 241: + . . . . *: 300 :AKEFLKGGTR :Sequence :======= :RP:SCP|13->247|1b0uA|8e-40|28.7|230/258|c.37.1.12 :========== :BL:SWS|1->250|YJKB_BACSU|e-141|100.0|250/250