[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAB13082.1 bsub0 yjkB "putative phosphate ABC transporter (ATP-binding protein)"
MEANDQTQNIPAISFRSVRKSYKQDGQTYDVLQDVTGDIQQGAIVAVLGPSGSGKSTLLS
MCNLMRTPDSGEVNIYGKEVREWNVNELRRTAALAFQSAPVLDGTVRDNLSLVQRLHQSQ
LYSPEKLASLAGLPPELLDRSARDLSGGQRQRLSLARTLSNPSSILLLDEITSALDPVSA
LEIEELIKRQHQEKKWTVMWVTHNMEQAKRIADTIWFMADGRLLEIAETDTFFSAPQHEA
AKEFLKGGTR
//