[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:ymaD"

ymaD        "putative peroxiredoxin-related protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1-1111---1--1111--------11111111111111111111-----------------------111----------------------------------------------------------------------------------------------------1------------1----------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------11-1-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MADHHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYII:Sequence : ccccccEEEccTTcEEEEETTcccEEEEcccGGTTcccccccHHHHHHHHHHHHHHH:Sec Str : =========================================================:RP:SCP|4->139|2onfA1|5e-29|23.1|130/139|d.227.1.1 : ===============================================:BL:SWS|14->142|Y3023_ACIAD|8e-08|27.5|120/143 : $$$$$$$$$$$$$$$$$$$$$$:RP:PFM|39->141|PF02566|8e-14|38.1|97/99|OsmC 61: . . . * . .: 120 :TLAAMMERSGLEKEDLQMESEGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLC:Sequence :HHHHHHHHTTcccccccEEEEEEEEEcccccEEEEEEEcEEEEEcccccHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|4->139|2onfA1|5e-29|23.1|130/139|d.227.1.1 :============================================================:BL:SWS|14->142|Y3023_ACIAD|8e-08|27.5|120/143 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|39->141|PF02566|8e-14|38.1|97/99|OsmC 121: . . + . . .: 180 :KKAESSCMISRAIQGNVELQLEASVKLGGE :Sequence :HHHHHHcHHHHHHTTTcccEEEETTE :Sec Str :=================== :RP:SCP|4->139|2onfA1|5e-29|23.1|130/139|d.227.1.1 :====================== :BL:SWS|14->142|Y3023_ACIAD|8e-08|27.5|120/143 :$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|39->141|PF02566|8e-14|38.1|97/99|OsmC