[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAB13612.1 bsub0 ymaD "putative peroxiredoxin-related protein"
MADHHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYII
TLAAMMERSGLEKEDLQMESEGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLC
KKAESSCMISRAIQGNVELQLEASVKLGGE
//