[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:ynaG"

ynaG        "conserved hypothetical protein"
YNAG_BACSU  "RecName: Full=Uncharacterized protein ynaG;"

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNVKKAAAVFSITIPIISAILIINFFTGFMSIPWQGMPVFFPLLLSPIGIILAFVSIKTN:Sequence : XXXXXXXXXXXX :SEG|12->23|itipiisailii :============================================================:BL:SWS|1->91|YNAG_BACSU|5e-42|100.0|91/100 61: . . . * . .: 120 :KRCAVYGIVLNAIMFPFPFFWFIGGALLFGV :Sequence :=============================== :BL:SWS|1->91|YNAG_BACSU|5e-42|100.0|91/100