[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAB13639.1 bsub0 ynaG "conserved hypothetical protein"
MNVKKAAAVFSITIPIISAILIINFFTGFMSIPWQGMPVFFPLLLSPIGIILAFVSIKTN
KRCAVYGIVLNAIMFPFPFFWFIGGALLFGV
//