[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:yoeD"

yoeD        "putative excisionase"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111--1111111---11--------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MYLTIEETAEYTNLSEDYIKSLVLEGKIRAVHDGEQFLIYKEQFKTHLEQLENYKALVQE:Sequence : GGHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHTTccccGGGGTTccGG:Sec Str 61: . . . * . .: 120 :ILNEPIPEDIDVKDED :Sequence :GcHHHHHH :Sec Str