[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:ywdA"

ywdA        "hypothetical protein"
YWDA_BACSU  "RecName: Full=Uncharacterized protein ywdA;"

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNIHEQKITPECLEKAANQVEDKREEYKDVLLQLKKMLGGTTPHSETAEILTRAYEQMKE:Sequence :============================================================:BL:SWS|1->82|YWDA_BACSU|3e-43|100.0|82/82 61: . . . * . .: 120 :YALFVQSIETFLRKSANNLKIK :Sequence :====================== :BL:SWS|1->82|YWDA_BACSU|3e-43|100.0|82/82