[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAB15829.1 bsub0 ywdA "hypothetical protein"
MNIHEQKITPECLEKAANQVEDKREEYKDVLLQLKKMLGGTTPHSETAEILTRAYEQMKE
YALFVQSIETFLRKSANNLKIK
//