[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:C08B11.1"

            ""
ZYG11_CAEEL  "RecName: Full=Early embryogenesis protein zyg-11;"

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------34446323332221532317F314451322423422323233343221212-1122-11232L21------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDHNAALTTCSTSAIPRLARLATERIAELIENDALPEFDHKVIASCSNDIFEVLRQKKKL:Sequence : :Sec Str : ===================================:RP:SCP|26->238|1o6sA2|3e-08|28.7|195/381|c.10.2.1 :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 61: . . . * . .: 120 :NHQTLQTMCSTSRFQINKIDLMGNKVELQDLELCSNQNLVSFRLGDIDYFPNTNKIQVAD:Sequence : HHHHHHHcccc EEccEEEccEEEEccccTTccGGcTTcEEEccE:Sec Str :============================================================:RP:SCP|26->238|1o6sA2|3e-08|28.7|195/381|c.10.2.1 :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 121: . . + . . .: 180 :VLDTALNRTSRQQLRHLDLSGRHRITSNWPTYVARKLPRLESLAFANRSTANETLSQIGA:Sequence :EEccccTTcccTTccEEEcccccccEEcTTTTEETTcTTccEEEcccccccEEcGGGGTG:Sec Str :============================================================:RP:SCP|26->238|1o6sA2|3e-08|28.7|195/381|c.10.2.1 :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 181: . * . . . .: 240 :SLLNLRFLDISSTCVTDISCISSLRNLEVLIMYNLNILKGDVTETLSNLTKLRVLDISRK:Sequence :GcTTccEEEcccccccccGGGTTcccccEEEccccccccccTTGGGGGcTTccEEEcTcc:Sec Str :========================================================== :RP:SCP|26->238|1o6sA2|3e-08|28.7|195/381|c.10.2.1 :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 241: + . . . . *: 300 :VNTDYLQETSQDAHLDLALGIYNRSVEAIESGTATPWAELRAIDMSGLSIVQFGTDRALA:Sequence :cccEEcTTccccccccEEEcTTcccccccHHHHHHHHccccEEEcTTccEcEccTTTTHH:Sec Str :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 301: . . . . + .: 360 :FVEKIIEAHPKLEQISLLATPLDSSLIEIPNRNLQVINTVSRRSIIFALSHYANLDRPAF:Sequence :HHHHHHHcccccTTTTGcTTTcEEEcGGGTTccTTccc :Sec Str :============================================================:RP:SCP|301->396|2fxtA1|9e-04|10.5|76/192|d.17.4.13 :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 361: . . . * . .: 420 :ITHALHSVYYQLQSGYDKFSQEELKECLRLVCISMQQGLNTLPVQIAGSACLYHLCKMKR:Sequence : HHHHHHHHHHHTTccTTTcccHHHHHHHHHHHHHHH:Sec Str :==================================== :RP:SCP|301->396|2fxtA1|9e-04|10.5|76/192|d.17.4.13 :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 421: . . + . . .: 480 :IKRLSVKEVNNCIERSLDAAEQYRSMTQLQKNVWLTICNDYLLHLDEIDFYRTCKVALDT:Sequence :TTccccccHHHHHHTTccGGGcHHHHHHHHHHTTcHHHHHHHHcccHHHH HHHHH:Sec Str :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 481: . * . . . .: 540 :MLLNRDASVERMTIAIVSIVTPKMRPSEAKILTTETKYVYHLVKIMNDYLEAYTREHRVG:Sequence :HHHcTTccHHHHHHHHHHHHHHTTcHHHHHH HTHHHHHHHGGGGTTc:Sec Str :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 541: + . . . . *: 600 :HERDNENALYTLKFTLSALWNLTDECPATCKAFLDAGGVQIAFRILKAFDYHGNVQTKVL:Sequence :cHHHHHHHH HHHHHHHHHHHHHTcHHHHHHHHHHHHHHHT TcccHHHHHHHH:Sec Str : =============================================:RP:SCP|556->685|1xqrA1|2e-06|13.6|118/264|a.118.1.21 :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 601: . . . . + .: 660 :GILNNLAEVEELHLGQLCKNEYISVLISCLDGSFNEVDSKGRYREVERSYFAAGILANLL:Sequence :HHHHHHHTTcHHHHHHHHHTTHHHHHGGGGGccccHH HHHHHHHHHHHc:Sec Str :============================================================:RP:SCP|556->685|1xqrA1|2e-06|13.6|118/264|a.118.1.21 :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 661: . . . * . .: 720 :TNTDGWESENQRDEACEKLLELIEQYPTLPSAMVSYKSFIPFSRIVRESNSNGAIMWCLW:Sequence : :Sec Str :========================= :RP:SCP|556->685|1xqrA1|2e-06|13.6|118/264|a.118.1.21 :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 721: . . + . . .: 780 :GVHHVLQHREKNKAPTYEKGYIEMFMDSGLSPIVEDMSHGHSKHIHNLDIRVVHLAREII:Sequence : :Sec Str :============================================================:BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799 781: . * . . . .: 840 :DIVSCHSLSSSPVRLVRRV :Sequence : :Sec Str : XXXXXXXXXXXX :SEG|787->798|slssspvrlvrr :====== :BL:SWS|1->786|ZYG11_CAEEL|0.0|100.0|786/799