[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAA86661.1 cele0 C08B11.1 "Probable RNA binding protein"
MDHNAALTTCSTSAIPRLARLATERIAELIENDALPEFDHKVIASCSNDIFEVLRQKKKL
NHQTLQTMCSTSRFQINKIDLMGNKVELQDLELCSNQNLVSFRLGDIDYFPNTNKIQVAD
VLDTALNRTSRQQLRHLDLSGRHRITSNWPTYVARKLPRLESLAFANRSTANETLSQIGA
SLLNLRFLDISSTCVTDISCISSLRNLEVLIMYNLNILKGDVTETLSNLTKLRVLDISRK
VNTDYLQETSQDAHLDLALGIYNRSVEAIESGTATPWAELRAIDMSGLSIVQFGTDRALA
FVEKIIEAHPKLEQISLLATPLDSSLIEIPNRNLQVINTVSRRSIIFALSHYANLDRPAF
ITHALHSVYYQLQSGYDKFSQEELKECLRLVCISMQQGLNTLPVQIAGSACLYHLCKMKR
IKRLSVKEVNNCIERSLDAAEQYRSMTQLQKNVWLTICNDYLLHLDEIDFYRTCKVALDT
MLLNRDASVERMTIAIVSIVTPKMRPSEAKILTTETKYVYHLVKIMNDYLEAYTREHRVG
HERDNENALYTLKFTLSALWNLTDECPATCKAFLDAGGVQIAFRILKAFDYHGNVQTKVL
GILNNLAEVEELHLGQLCKNEYISVLISCLDGSFNEVDSKGRYREVERSYFAAGILANLL
TNTDGWESENQRDEACEKLLELIEQYPTLPSAMVSYKSFIPFSRIVRESNSNGAIMWCLW
GVHHVLQHREKNKAPTYEKGYIEMFMDSGLSPIVEDMSHGHSKHIHNLDIRVVHLAREII
DIVSCHSLSSSPVRLVRRV
//