[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:C13F10.4"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----111-----111111111111111111111111111111111112111111111111111-1-------11111-111--1-111-12111111111111111-1-121322352232222252627N2242722224222222222222622232--41111321111111----------11-1111------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDETHSLLLNEEALEACPEQKRPVFIYEWLRYLDRILPITQREDLKNVQKELQQQLESRL:Sequence : :Sec Str :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 61: . . . * . .: 120 :HTVVGPPTRKLIARCIGRVYALTGDIVSLNTLLNSCNDTLKVKDESPKAVQSKLAALACL:Sequence : :Sec Str : =======================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 121: . . + . . .: 180 :SAVYDSMGRMAGRSIEDTLAIVKNWMSTAVAHSQAHIMNTLTSMVKALGSGDYVTHKKIH:Sequence : HHHHT:Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 181: . * . . . .: 240 :SIAKNSLQDRTLCKTPNVKIASLECLTALVQFHTPIYTTELEASCTMCIKILEGSTYELR:Sequence :TccGGGccHHHHHHHHHHHHHHHHHHHHHHHHcGGGTGGGHHHHHHHHHHHHHcTTGGG :Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 241: + . . . . *: 300 :CAVAKFTAQLLATSMKPPPGAVIKAKSNQTVPVRPASVTDTLNLLASGFLRGGIGGFLKG:Sequence : THHHHHHHHHHHHHHHG GGGHHHHHHHHHHHHHHHHcTTcHHHHHHHHH:Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 301: . . . . + .: 360 :SSSTFSTMGRSDIRIGVSICYVEMVREMGSAWLEKHLIAVCCHMVDLASKCGHLAYTQNA:Sequence :HHHHHHHTGGGGHHHHHHHHHHHHHHHHcTTccTTHHHHHHHHHHHHHHHHGGGGHHHHH:Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 361: . . . * . .: 420 :SHVSEALTIRRCISFILRQTIGSLLGENAQTLACKHLGVLLSQYVDLVSIGTGDNLDSSV:Sequence :HHHHHHHHHHTcccccccHHHHHHHHHHHHHHHTTTcHHHHGGGHHHHHHHHHHHHHcHH:Sec Str : XXXX:SEG|417->429|dssvdssdygsgy :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 421: . . + . . .: 480 :DSSDYGSGYAIIVILQEISVLVRQIGTSVMSLFTEATGIMEHIFKCLTHPLASARYAAAW:Sequence :HHTcHHHHHHHHHHHHHHHHHcTT cTTGGGTTcHHHHHHHHHHHHTTcccHHHHHHHHT:Sec Str :XXXXXXXXX :SEG|417->429|dssvdssdygsgy :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 481: . * . . . .: 540 :CLRCIATAVPNLMTPLIDRCLPRLDQLSSSSRAISGFSMALSALLAASTDSSKLGIPYAK:Sequence :THHHHHHHccHHHHTHHHHHHHcccccHHHHH :Sec Str : XXXXXXXXXXXXXXX :SEG|520->534|alsallaastdsskl :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 541: + . . . . *: 600 :PLKVLDLAEEMLRTSTQQPKLTIAKLESGWNLIYALIHLGPSVMKEHLPRVIKLWKAAFA:Sequence : :Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 601: . . . . + .: 660 :RSAKEAESENSRGDAFSWQCAMIAQAGALSVMEAVASQPELSSTNNALDAMKVPIECSLV:Sequence : :Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 661: . . . * . .: 720 :MMSQVGNLIKSYGNEMRQANSVVRIRLYRLLLLLPHKSFEGSYAALLRELVADITLSDNS:Sequence : :Sec Str : XXXXXXXXXXX :SEG|684->694|rirlyrlllll :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 721: . . + . . .: 780 :QSTLTTSLPISQFTGVEKILISPVYDATDYSMVEDLLQTPISSVSLGNIEEDLSNLIRAS:Sequence : :Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 781: . * . . . .: 840 :ASQIGDTWPENDSEPLTCLNTALLTYGKVFPLVNNKHKVQITEHFWDTIQKSKNAGRKQA:Sequence : :Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 841: + . . . . *: 900 :ILVNALTAKLLSYKTLCEQRGHKLDNETLQRASFDLISSSLSNSCPMTRLVGAEALARLS:Sequence : cHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXX :SEG|873->884|sfdlissslsns :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 901: . . . . + .: 960 :QAVNSPPFVASIAQYCFDKLNSCKDEINRSGHVLALGCLHRHVGSLGSGQHLNTGVSVVL:Sequence :HHcHHHHHHHHHHHHHHHHTcTTccHHHHHHHHHHHHTTTccccHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 961: . . . * . .:1020 :ALAEESKMPKVQTCALVAMALIAETGSGMFRVFVETTLSSCLKLLISTPTFVVDVVQGIS:Sequence :HccHHHHcHHHHHHHHHHHTHHHHHHHHHGGGTccTTHHHHHHHHTcTTccHHHHHHHHH:Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1021: . . + . . .:1080 :KCLTALITCVGPELSCPGVIDGVRTSLLAACAIQLSHSDPFVQAEAISGLQQMHLFAPRY:Sequence :HHHHHHHHHccccHHccccccccHHHHHHHHHTcTTcccHHHHHHHHHHHHHHTTTTHHH:Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1081: . * . . . .:1140 :VHMAQLVVDISSLLSSTHLVIRRQSVSCLRQLVQRESKEVRNHAQVLVPQGIVDTNKKKF:Sequence :HHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHGGGcHHHHHHTHHHHHHHHHTccc:Sec Str :============================================================:RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1141: + . . . . *:1200 :ALPESGLEGALFGMLDTEVNKELRCHLQETLISLVQGTSGELLNNWLMLSKEILATSNDH:Sequence :HHHHHHHHHHHHHHHHHHHHHHHcTTcccccccHHHHHHHHHHHHHHHHTTcccccTTcc:Sec Str :=========================================================== :RP:SCP|66->1199|1u6gC|8e-20|10.0|1065/1146|a.118.1.2 :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1201: . . . . + .:1260 :GLVRKKEEKKDRGEDDADDDDDEDGDDDTNLAGISSLMEEDKGKVQPRWPTKVFTMEIVN:Sequence :cccH HHHHHHHHHHHHH HHGGGGHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXX :SEG|1204->1228|rkkeekkdrgeddadddddedgddd :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1261: . . . * . .:1320 :RLMSVCDTERAHLDMALAKELQITSAGKNDYLVLHLSDLVRMSFMAATSDNSLLRIAGLK:Sequence :HHHHTTcccHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHGGGcccHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1321: . . + . . .:1380 :SLEEVIIRFSSCPEPEFPGHMILEQFQAQVGAALRPAFTDDTPSNVTSVACQVCSTWIGS:Sequence :HHHHHHHHHGGGccTTTTHHHHHHHHH HHHTccHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1381: . * . . . .:1440 :GVARDLSDLKRVHQLLVSSLNKLKHGSINVQLYSESAATLEKLSILKAWAEVYVTAIEQD:Sequence :TTccccGGGGGHHHHHHHHHHHHTcccc GGGHHHHHHHHHHHHHHHccGGGHHHHHHH:Sec Str :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1441: + . . . . *:1500 :RMKNENVEARDHYDYNGSGSLLSLVEPEANSLIAYWLAMLNDSALLALPAHYSDQFLNRG:Sequence :HHHHHH :Sec Str :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1501: . . . . + .:1560 :GAFFNAHSAEACREYYQICWPPILLACSTWLSKNNFELPSGIELSSETAAVWRDEGNVSR:Sequence : :Sec Str :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1561: . . . * . .:1620 :FYLLIGIAVESLSNKTRQIEDETIQMSVKSLTRLLSCEWCQLHLMSDVPAVIEILYVLHR:Sequence : :Sec Str :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1621: . . + . . .:1680 :SVLTRDCLSTQLQCIECVGSIIDAAQLAIRICASRDISNGNLESEDTLRKIPNVLFAGEE:Sequence : :Sec Str :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1681: . * . . . .:1740 :GGKDGNINKDGVKTISYAILELAVCAIFKQMPQINSAQLKTNSLAALHLRKVGRLPAEGT:Sequence : :Sec Str :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1741: + . . . . *:1800 :HLVIKSMQILVQIPSLCSPHSRVTVLPVIMYLLLGFVRESARLDEGSIQTDRAGHLSAIA:Sequence : :Sec Str : XXXX:SEG|1797->1814|saiaaaaiqsirsivsqq :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1801: . . . . + .:1860 :AAAIQSIRSIVSQQPDDDTAVSWKTIMRNAFYSVLNMSEDNERIQLDKCIIMVTAVVFTT:Sequence : :Sec Str :XXXXXXXXXXXXXX :SEG|1797->1814|saiaaaaiqsirsivsqq :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1861: . . . * . .:1920 :SAPVDVVLGHQESFNKLIVLLKRHLQSDNVSVVMKTLQSLASIFGRKGFGGIFVKHLGKE:Sequence : :Sec Str :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1921: . . + . . .:1980 :IMPVVKRYLSKVDCENEKITESDLVILQECVKVIEVLAMSAKDGKRIQVISLLVQLLVRL:Sequence : :Sec Str : XXXXXXXXXXXXXXX:SEG|1966->1982|riqvisllvqllvrllr :============================================================:BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 1981: . * . . . .:2040 :LRATSHTEWRKVGPIEKKLHEMAIGRLNAAASMWPAEFKKVIEWNNELKTRLESALLLQS:Sequence : :Sec Str :XX :SEG|1966->1982|riqvisllvqllvrllr :======================================================== :BL:SWS|1->2036|HTR5B_MOUSE|0.0|36.8|1972/2070 2041: + . . . . *:2100 :TRHAHQISMAKTQEAKTTPVVQQPRIRLTMFGAESN :Sequence : :Sec Str