[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:D2013.7"

            ""
EIF3F_CAEEL  "RecName: Full=Eukaryotic translation initiation factor 3 subunit F;         Short=eIF3f;AltName: Full=Eukaryotic translation initiation factor 3 subunit 5;"

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 2112331-2---222-111-111111111111111-111111111111111111-11111-11------1---1----------1111-12112211211111111-13-2111111112111111111393-125-1121-11--111-1111111111111111-3111-1112222U---3231731322222221 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MASNLTVNVHPGVYMNVVDTHMRRTKSSAKNTGQEKCMGTLMGYYEKGSIQVTNCFAIPF:Sequence : ccccEEEEEEEEcccEEEEEEEEEccE:Sec Str :============================================================:BL:SWS|1->294|EIF3F_CAEEL|e-169|100.0|294/294 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->94|PF01398|3e-12|38.3|81/113|Mov34 61: . . . * . .: 120 :NESNDDLEIDDQFNQQMISALKKTSPNEQPVGWFLTTSDITSSCLIYHDYYVRVITEASA:Sequence :EEccccTTccHHHHHHHHHHHHHcccccEEEEEEEccccccTTHHHHHHH H:Sec Str :============================================================:BL:SWS|1->294|EIF3F_CAEEL|e-169|100.0|294/294 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->94|PF01398|3e-12|38.3|81/113|Mov34 121: . . + . . .: 180 :RRESPPIVVLTIDTTFSGDMSKRMPVRAYLRSKAGIPGAAGPHCAIFNPLRVELAAFPGE:Sequence :HTTcTTcEEEEEcc ccccccEEEEE :Sec Str :============================================================:BL:SWS|1->294|EIF3F_CAEEL|e-169|100.0|294/294 181: . * . . . .: 240 :LVAMQLIEKALDSRRREATLESGLEQLETSTAQMIEWLERMLHYVEDVNKNGEKPGDAQI:Sequence : :Sec Str :============================================================:BL:SWS|1->294|EIF3F_CAEEL|e-169|100.0|294/294 241: + . . . . *: 300 :GRQLMDIVTASSNNMQPEKLDTLVKNTLRDYVMVSYLAKLTQTQLQVHERLVSA :Sequence : :Sec Str :====================================================== :BL:SWS|1->294|EIF3F_CAEEL|e-169|100.0|294/294