[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:F09E5.2"

            ""
            ""

OrgPattern ----111-1111-112-11----1---1------2-----------311-22---11-2-1------- --1----------1---11-1----111111--111-------------------------1------11-1---111-----1-11111-1---------1---11--1---------------------1--11-111111-2---2--11--22------2-1111----11-----11--2---22---------1--1---1-------1----1-----------131-----------------1-----------------------------------------------------------------------1--1-----------1111------1------1----5-21-321221--111------------------------------------1--1------1--111-111-1-----------------------------------------------------------------------------11111----111111--------------1----------1----------------1----1--11----11-1-1------1------31--------------------2--1111---1----1------------------------1--1-----------------------------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------11--22--------------------------------------12--1-111---- --32212-212-11311222233322322222222222222222221122231412122221111111-11111111-1111111111-24212221112121324-11243211132111-22421213C2-336211-312222211122-41222112321221211153311111F1111111352211112221 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVRVTILHPDLGIGGAERLIVDAAVGLQDRGHSVRIFTNQYSRSHCFQETLDLDICTVVP:Sequence :HHEEEEEcTTcccccHHHHHHHHHHHHHHTTcEEEEEEEcccGGGccEEEEETTEEEEEE:Sec Str : ================================================:RP:SCP|13->400|1gz5A|3e-42|8.6|384/456|c.87.1.6 : =========================================================:BL:SWS|4->396|ALG2_MOUSE|4e-97|46.8|391/415 61: . . . * . .: 120 :WIPRSIFGKGHALCAYLKMIIAALYIVIYHKDTDVILSDSVSASQFVLRHFSKAKLVFYC:Sequence :cccccccGGGGGGGHHHHHHHHHHHHHHHTccccEEEEEHHHHHHHHHHHHHHHTccEEE:Sec Str :============================================================:RP:SCP|13->400|1gz5A|3e-42|8.6|384/456|c.87.1.6 :============================================================:BL:SWS|4->396|ALG2_MOUSE|4e-97|46.8|391/415 121: . . + . . .: 180 :HFPDRLLTKRDGNLKAFYRNIIDWIEEYTTGLADVICVNSNFTKNVVRETFKSLASQELT:Sequence :EccccTcHHHHcccccHHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHHHcccGGGGEE:Sec Str :============================================================:RP:SCP|13->400|1gz5A|3e-42|8.6|384/456|c.87.1.6 :============================================================:BL:SWS|4->396|ALG2_MOUSE|4e-97|46.8|391/415 181: . * . . . .: 240 :VLYPSLNTEFFDSIEASDDFGEEIPRGTKYVFTSLNRFERKKNIVLALDAFEKLKSNLPA:Sequence :EccccccTTTcccccHHHHHHTTcccccEEEEEEEccccGGGcHHHHHHHHHHHHHHcTT:Sec Str :============================================================:RP:SCP|13->400|1gz5A|3e-42|8.6|384/456|c.87.1.6 :============================================================:BL:SWS|4->396|ALG2_MOUSE|4e-97|46.8|391/415 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|209->373|PF00534|4e-15|39.3|150/165|Glycos_transf_1 241: + . . . . *: 300 :DEFSQCHLVIAGGYDLKNPENIEHYDELVEHMKKLELPADQIVFLHSPSDTQKVNLIRRS:Sequence :ccccTccEEEEEEccccHHHHHHcccHHHHHHHHTTcTTTTEEEEccccHHHHHHHHHHc:Sec Str :============================================================:RP:SCP|13->400|1gz5A|3e-42|8.6|384/456|c.87.1.6 :============================================================:BL:SWS|4->396|ALG2_MOUSE|4e-97|46.8|391/415 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|209->373|PF00534|4e-15|39.3|150/165|Glycos_transf_1 301: . . . . + .: 360 :RAVLYTPDREHFGIVPVEAMYLGTPVIAVNTGGPCESVRNNETGFLVDQTAEAFAEKMID:Sequence :cEEEEccccccccHHHHHHHHTTccEEEEccTTHHHHcccTTTEEEEcccHHHHHHHHHH:Sec Str :============================================================:RP:SCP|13->400|1gz5A|3e-42|8.6|384/456|c.87.1.6 :============================================================:BL:SWS|4->396|ALG2_MOUSE|4e-97|46.8|391/415 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|209->373|PF00534|4e-15|39.3|150/165|Glycos_transf_1 361: . . . * . .: 420 :LMKDEEMYRRMSEEGPKWVQKVFAFEAFARKLDEIIQSTL :Sequence :HHHcHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHH :Sec Str :======================================== :RP:SCP|13->400|1gz5A|3e-42|8.6|384/456|c.87.1.6 :==================================== :BL:SWS|4->396|ALG2_MOUSE|4e-97|46.8|391/415 :$$$$$$$$$$$$$ :RP:PFM|209->373|PF00534|4e-15|39.3|150/165|Glycos_transf_1