[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAN63415.1 cele0 F09E5.2 "AHPC\/TSA protein"
MVRVTILHPDLGIGGAERLIVDAAVGLQDRGHSVRIFTNQYSRSHCFQETLDLDICTVVP
WIPRSIFGKGHALCAYLKMIIAALYIVIYHKDTDVILSDSVSASQFVLRHFSKAKLVFYC
HFPDRLLTKRDGNLKAFYRNIIDWIEEYTTGLADVICVNSNFTKNVVRETFKSLASQELT
VLYPSLNTEFFDSIEASDDFGEEIPRGTKYVFTSLNRFERKKNIVLALDAFEKLKSNLPA
DEFSQCHLVIAGGYDLKNPENIEHYDELVEHMKKLELPADQIVFLHSPSDTQKVNLIRRS
RAVLYTPDREHFGIVPVEAMYLGTPVIAVNTGGPCESVRNNETGFLVDQTAEAFAEKMID
LMKDEEMYRRMSEEGPKWVQKVFAFEAFARKLDEIIQSTL
//