[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:F10G7.2"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1---111-3111111-1111111111111111111111111111111111111111111111111----1--111------1111111-12111111111111111-11161112331111131121223F1-331111121131121111111-2-222212111113131121-111A2111-1122121112311- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTDAAAATPTVPPPAASSANPAVRRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTA:Sequence : EEEEEEEEccccEEEEEETTEEETTEEEEEEETTEEc:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|4->23|aaaatptvpppaassanpav : ====================================:RP:SCP|25->167|1a2tA|9e-16|20.0|130/135|b.40.1.1 : =====================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 : $$$$$$$$:RP:PFM|53->167|PF00565|2e-09|35.6|104/107|SNase 61: . . . * . .: 120 :PRLGRRPTDSASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSP:Sequence :ccccccccGGGTTTcccTTHHHHHHHHHHHHHccccEEEEEcccccccTTccEEETEEEE:Sec Str :============================================================:RP:SCP|25->167|1a2tA|9e-16|20.0|130/135|b.40.1.1 :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|53->167|PF00565|2e-09|35.6|104/107|SNase 121: . . + . . .: 180 :ADAENVAEGAVSAGLLEVRQGKVADEYSTKLLELQEQAKSAGRGKWNSNAGTIRDIRWVI:Sequence :ETTEEHHHHHHHTTccEEcccTTccTTHHHHHHHHHHHHHTTcGGGccccccEEcTTcHH:Sec Str :=============================================== :RP:SCP|25->167|1a2tA|9e-16|20.0|130/135|b.40.1.1 :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|53->167|PF00565|2e-09|35.6|104/107|SNase 181: . * . . . .: 240 :DNPRELVDKYAQKPIDAVIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADSR:Sequence :HHHHHHHHHHHcccEEEEEEEEccccEEEEEEEETTEEEEEEETTEEccTTccTTHHHHH:Sec Str : XX:SEG|239->255|sraeafseeakffaesr : ==============================================:RP:SCP|195->326|1a2tA|4e-07|20.4|126/135|b.40.1.1 :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 241: + . . . . *: 300 :AEAFSEEAKFFAESRLLQRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWS:Sequence :HHHHHHHHHHHHHHHHHTcccEEEEEccccccEEEEEEETTEEHHHHHHHTTccEEEccc:Sec Str :XXXXXXXXXXXXXXX :SEG|239->255|sraeafseeakffaesr :============================================================:RP:SCP|195->326|1a2tA|4e-07|20.4|126/135|b.40.1.1 :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 301: . . . . + .: 360 :IGLCTGGAQKLRDAERQAKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQK:Sequence :cTTccTTHHHHHHHHHHHHHTTcGGGTTcc ccEEEEEEEEEETTTEEEEEc:Sec Str :========================== :RP:SCP|195->326|1a2tA|4e-07|20.4|126/135|b.40.1.1 : ==================:RP:SCP|343->472|1a2tA|2e-14|13.8|116/135|b.40.1.1 :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 361: . . . * . .: 420 :DDGSEVKLHLSSIRLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQ:Sequence :TTccEEEEEETTEEccccTTTTcccGGGTTTccHHHHcTTHHHHHHHHHHHHTTcEEEEE:Sec Str :============================================================:RP:SCP|343->472|1a2tA|2e-14|13.8|116/135|b.40.1.1 :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 : $$$$$$$$$$$$$$$$$$$$$$:RP:PFM|399->473|PF00565|2e-07|36.8|67/107|SNase 421: . . + . . .: 480 :IDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTLLAAEA:Sequence :EEEEEccccccccEEEEEEEETTEEHHHHHHHTTccEEcccccTTccccTTHHHHHHHHH:Sec Str : XXXXXX:SEG|475->489|llaaeanaekgkkgl :==================================================== :RP:SCP|343->472|1a2tA|2e-14|13.8|116/135|b.40.1.1 :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|399->473|PF00565|2e-07|36.8|67/107|SNase 481: . * . . . .: 540 :NAEKGKKGLFADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLR:Sequence :HHHHTTcGGGcccccc ccccEEcTTcHHHHHHHHHHHHHTcEEEEEEEEEccccEEE:Sec Str :XXXXXXXXX :SEG|475->489|llaaeanaekgkkgl :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 541: + . . . . *: 600 :IYIPKETVLITFLLGGINCPKGARVGPGGVSTGAAEPFADEAAAFTRKLVLQHEVQLEVE:Sequence :EEETTTTEEEEEEEccEEcccccEEETTEcTEEcccTTHHHHHHHHHHHHTTcEEEEEEE:Sec Str : XXXXXXXXXXXX :SEG|574->585|aaepfadeaaaf :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|554->639|PF00565|9e-05|33.7|74/107|SNase 601: . . . . + .: 660 :STDKNGNFVGYLYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYNALLSAENKAKK:Sequence :EEcTTccEEEEEEETTTT TTEEHHHHHHHTTccEEcGGGTTcTTHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXX:SEG|649->668|nallsaenkakkakkniwan :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|554->639|PF00565|9e-05|33.7|74/107|SNase 661: . . . * . .: 720 :AKKNIWANFTEEQHQEEVEVQQADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEK:Sequence :HTcGGGccccHHHTcGGGcccccccccccccccEEEEEEEEcTTcEEEEEEGGGHHHHHH:Sec Str :XXXXXXXX :SEG|649->668|nallsaenkakkakkniwan : XXXXXXXXXXXX :SEG|671->682|eeqhqeevevqq : ====:RP:SCP|717->808|2diqA1|7e-18|24.4|90/97|b.34.9.1 :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|700->808|PF00567|4e-19|41.5|106/120|TUDOR 721: . . + . . .: 780 :MTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQAEIVYIDYGNR:Sequence :HHHHHHHHHHHccccTTcccccTTcEEEEEcTTTccEEEEEEEEEETTEEEEEETTTccE:Sec Str :============================================================:RP:SCP|717->808|2diqA1|7e-18|24.4|90/97|b.34.9.1 :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|700->808|PF00567|4e-19|41.5|106/120|TUDOR 781: . * . . . .: 840 :ETIEAVKLAQIPAGFANFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSE:Sequence :EEEcGGGEEcccGGGcTTTcccEEEEETTEEccccHHHHHHHHHHHHHHHTTEEEEEEEE:Sec Str :============================ :RP:SCP|717->808|2diqA1|7e-18|24.4|90/97|b.34.9.1 :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|700->808|PF00567|4e-19|41.5|106/120|TUDOR 841: + . . . . *: 900 :YKVGTSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSR:Sequence :EccccccEEEEEETEETTcccHHHHHHHTTccEEcccccGGGHHHHHHHHHHHHTcHHTT:Sec Str :============================================================:BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910 901: . . . . + .: 960 :KNIWEYGDFTGNDI :Sequence :cGGGTTc :Sec Str :============= :BL:SWS|24->913|SND1_PONAB|0.0|44.0|868/910