[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:F20D1.1"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------2-111-111--11141111251-111--111111--111---1-121--1-11111131311111------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGAAASGVSTQMQAEHDPNAAFPWWVRFLAKGVAILGGFLSLFFGVLGLITLSATCMVAI:Sequence : XXXXXXXXXXXXXX :SEG|36->49|lggflslffgvlgl : =====================================:BL:SWS|24->144|CI007_MOUSE|2e-19|33.1|121/171 : $$$$$$$$$$:RP:PFM|51->142|PF10233|8e-11|35.9|92/112|Cg6151-P 61: . . . * . .: 120 :LLQMTAGALVIALEAPFCCQFVDFIEKIARFSESRALWHKAAIYGAMGLIPIFLCIELNT:Sequence :============================================================:BL:SWS|24->144|CI007_MOUSE|2e-19|33.1|121/171 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|51->142|PF10233|8e-11|35.9|92/112|Cg6151-P 121: . . + . . .: 180 :ILGSGTIFASGVIYGFMALGKKADRSNMMAAGDPAWSPQVNQSNIP :Sequence :======================== :BL:SWS|24->144|CI007_MOUSE|2e-19|33.1|121/171 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|51->142|PF10233|8e-11|35.9|92/112|Cg6151-P