[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:F25D7.1"

            ""
DERL1_CAEEL  "RecName: Full=Derlin-1;AltName: Full=DER1-like protein 1;AltName: Full=cDerlin-1;AltName: Full=Coelomocyte uptake defective protein 2;"

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 2111222162111222221-11111121111111-1111111111---111111111-11112-----1-----------------11-13221111221111231123236323332322332442538F4-4352322222422332223233352246322222222122232222N3221331151322212223 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDLENFLLGIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIY:Sequence : ===================================================:RP:SCP|10->188|2ic8A1|1e-07|17.7|175/182|f.51.1.1 :============================================================:BL:SWS|1->245|DERL1_CAEEL|e-152|100.0|245/245 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->190|PF04511|2e-24|39.9|178/194|DER1 61: . . . * . .: 120 :YPVTPQTGFHWLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFL:Sequence :============================================================:RP:SCP|10->188|2ic8A1|1e-07|17.7|175/182|f.51.1.1 :============================================================:BL:SWS|1->245|DERL1_CAEEL|e-152|100.0|245/245 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->190|PF04511|2e-24|39.9|178/194|DER1 121: . . + . . .: 180 :LEPMVISVLYVWCQVNKDTIVSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGH:Sequence :============================================================:RP:SCP|10->188|2ic8A1|1e-07|17.7|175/182|f.51.1.1 :============================================================:BL:SWS|1->245|DERL1_CAEEL|e-152|100.0|245/245 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->190|PF04511|2e-24|39.9|178/194|DER1 181: . * . . . .: 240 :AYFFVALKYPDEYGVDLISTPEFLHRLIPDEDGGIHGQDGNIRGARQQPRGHQWPGGVGA:Sequence :======== :RP:SCP|10->188|2ic8A1|1e-07|17.7|175/182|f.51.1.1 :============================================================:BL:SWS|1->245|DERL1_CAEEL|e-152|100.0|245/245 :$$$$$$$$$$ :RP:PFM|10->190|PF04511|2e-24|39.9|178/194|DER1 241: + . . . . *: 300 :RLGGN :Sequence :===== :BL:SWS|1->245|DERL1_CAEEL|e-152|100.0|245/245