[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:F53A3.7"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1111111-311-231-------1-------------1111111-----------111111111111111111111111111111-111-1-1-117-111--1111-13-21111111---11111-11141-112----1--1-21---1--1112111--1111-111-11111-11411-1-1121111--11111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLRSAVSALYRASRSFSETVPRLSATPLGKQEPQLSLSYTCKVCNSREGPKTFAKSSYEK:Sequence : ccEEEEEEEETTTTEEEE EEEEHHHHHT:Sec Str : ====================================:BL:SWS|25->104|DNLZ_HUMAN|9e-21|59.5|79/178 : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|35->100|PF05180|2e-19|62.5|64/66|zf-DNL 61: . . . * . .: 120 :GVVIVTCSGCHNHHIIADNIGWFEDFKGKNIEDHLKTRGEAVKRRDTIKNENGIFEIQK :Sequence :cEEEEEcTTTccEEEcccccccGGGcc ccHHHHHHHHcccccc :Sec Str :============================================ :BL:SWS|25->104|DNLZ_HUMAN|9e-21|59.5|79/178 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|35->100|PF05180|2e-19|62.5|64/66|zf-DNL