[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:R09B5.3"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIRSILILLVALIAFSTAQYGYGGYPGMMGGYGGYPGMMGGYGMRPYGMGYGMGMGGMGM:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|20->71|ygyggypgmmggyggypgmmggygmrpygmgygmgmggmgmyrpgllgmlmg 61: . . . * . .: 120 :YRPGLLGMLMGK :Sequence :XXXXXXXXXXX :SEG|20->71|ygyggypgmmggyggypgmmggygmrpygmgygmgmggmgmyrpgllgmlmg