[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:Y105E8A.25"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIVEEEMRSGGGTARPVTPRSIANSLDSLSECAQHHHHHSDVVNANSNSDRSRSLGDLLA:Sequence 61: . . . * . .: 120 :ATMQDGNDDSLRNGSYDTLVTTTTKGGGLTDSGIGGGLLLMKGEDEMDIMDDHNSSSSPD:Sequence : XXXXXXXXXXXXXXXXXXXXXXX :SEG|78->100|tlvttttkgggltdsgiggglll : XXXXXXXXXX:SEG|111->122|ddhnsssspdhh 121: . . + . . .: 180 :HHRIPTDISSPDSFTYPPVSFTSYDPVNGSGSVPSYSNENTNPLDSTPRGHSADDRKHSD:Sequence :XX :SEG|111->122|ddhnsssspdhh 181: . * . . . .: 240 :LPAISEESEHEQQSIHIPYNHYPPHSSSVGPGAAPAVREVVEHTYPMVHCNSAPSNTVFN:Sequence : XXXXXXXXXXXXXX :SEG|184->197|iseeseheqqsihi 241: + . . . . *: 300 :SDRIAHRRVVSDDVTETTRLKRSEELENMDKVGRISFEKRSASTNHLSKSRKGATLVFHN:Sequence 301: . . . . + .: 360 :DPNEKDETDDEEEYEDAADGYSKDNEMLILEKSGGEERYRMASVKKKNGSPLRHFDNHSN:Sequence :XXXXXXXXXXXXXXXXXXX :SEG|301->319|dpnekdetddeeeyedaad 361: . . . * . .: 420 :LTSISSTEPPPVRLPRRVSAVSSTSRSSPQRATDQSWKDKMPPFGIVGHSVSLDREID :Sequence : XXXXXXXXXXXXXXXXXXX :SEG|375->393|prrvsavsstsrsspqrat