[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAD21671.1 cele0 Y105E8A.25 "serine\/threonine protein phosphatase"
MIVEEEMRSGGGTARPVTPRSIANSLDSLSECAQHHHHHSDVVNANSNSDRSRSLGDLLA
ATMQDGNDDSLRNGSYDTLVTTTTKGGGLTDSGIGGGLLLMKGEDEMDIMDDHNSSSSPD
HHRIPTDISSPDSFTYPPVSFTSYDPVNGSGSVPSYSNENTNPLDSTPRGHSADDRKHSD
LPAISEESEHEQQSIHIPYNHYPPHSSSVGPGAAPAVREVVEHTYPMVHCNSAPSNTVFN
SDRIAHRRVVSDDVTETTRLKRSEELENMDKVGRISFEKRSASTNHLSKSRKGATLVFHN
DPNEKDETDDEEEYEDAADGYSKDNEMLILEKSGGEERYRMASVKKKNGSPLRHFDNHSN
LTSISSTEPPPVRLPRRVSAVSSTSRSSPQRATDQSWKDKMPPFGIVGHSVSLDREID
//