[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:Y111B2A.11"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------1---------------1----------------------------------------------------------------------------------1-1--21422351222222422225F2-42521123-1422222231242232212-2111121111111------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MATTSKAFRARALDSNRSMTVYWGHELPDLSECSVGNRAVTQMPSGMEKEEEQEKHLQEA:Sequence : XXXXXXXXXXXX :SEG|48->59|ekeeeqekhlqe : ======================================================:BL:SWS|7->398|EPC2_XENTR|1e-41|33.9|375/804 61: . . . * . .: 120 :IAAQQASTSGIQLNHVIPTPKVDRVEDQRYHSTYHNKNKMHRSKYIKVHAWQALERDEPE:Sequence : XXXXXX:SEG|115->128|erdepeydydtede :============================================================:BL:SWS|7->398|EPC2_XENTR|1e-41|33.9|375/804 121: . . + . . .: 180 :YDYDTEDEAWLSDHTHIDPRVLEKIFDTVESHSSETQIASEDSVINLHKSLDSSIVYEIY:Sequence :XXXXXXXX :SEG|115->128|erdepeydydtede :============================================================:BL:SWS|7->398|EPC2_XENTR|1e-41|33.9|375/804 181: . * . . . .: 240 :EYWLSKRTSAATTSGCVGVGGLIPRVRTECRKDGQGVINPYVAFRRRAEKMQTRKNRKND:Sequence :============================================================:BL:SWS|7->398|EPC2_XENTR|1e-41|33.9|375/804 241: + . . . . *: 300 :EDSYEKILKLVHDMSKAQQLFDMTARREKQKLALIDMESEILAKRMEMSDFGGSPSSFNE:Sequence :============================================================:BL:SWS|7->398|EPC2_XENTR|1e-41|33.9|375/804 301: . . . . + .: 360 :ITEKIRAAATLEVVKPPLAEINGSDEVKKRKKPRRKIADKDLISKAWLKKNAESWNRPPS:Sequence :============================================================:BL:SWS|7->398|EPC2_XENTR|1e-41|33.9|375/804 361: . . . * . .: 420 :LFGQHSGNVPTVTTKPVRESLANGRFAFKRRRGCVYRAALTVYNVPTAPATVPPVQTQAA:Sequence : XXXXXXXXXXXXXXXX:SEG|405->429|vptapatvppvqtqaavasssssks :====================================== :BL:SWS|7->398|EPC2_XENTR|1e-41|33.9|375/804 421: . . + . . .: 480 :VASSSSSKSTDMVPSNMKFFETFVRDSQDSVSRSLGFVRRRMGRGGRVVFDRMPRNRDDN:Sequence :XXXXXXXXX :SEG|405->429|vptapatvppvqtqaavasssssks : XXXXXXXXXXXXXXXXXX :SEG|456->473|gfvrrrmgrggrvvfdrm 481: . * . . . .: 540 :DERTSTDPWAEYCVADSSRTFRARNSSLGTEEETDDLSPKSLYFARSNRFAFNDDETERE:Sequence 541: + . . . . *: 600 :WTSRCQQSSWRDTEVDDELKKRETTSEKFTETTTNGSTKTHTESDDSEVERMEVDDQVDE:Sequence : XXXXXXXXXXXXXXX :SEG|560->574|kkrettsekftettt 601: . . . . + .: 660 :AQITVSSSKDDGMNGNDKNEDEEDDDDDMDVDEHQTVVGVHQHQQQQHHQQKVRHQMNGG:Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|609->630|kddgmngndknedeedddddmd : XXXXXXXXXXXXXXXXXXXXXXX :SEG|634->656|hqtvvgvhqhqqqqhhqqkvrhq : XX:SEG|659->665|ggggggg 661: . . . * . .: 720 :GGGGGVVKLKPPLQELSPPLSGNGRADRAEPTPVPAKMCGTVSDSDDWREPSGSPSESNS:Sequence :XXXXX :SEG|659->665|ggggggg : XXXXXXXXXXX:SEG|710->721|epsgspsesnss 721: . . + . . .: 780 :STEWGGYTPQEQHAVVVANAVAVAFKEKLMNGVDDDDDQQPSPARGARDHSIKDSMSTVT:Sequence :X :SEG|710->721|epsgspsesnss : XXXXXXXXXXX :SEG|734->744|avvvanavava 781: . * . . . .: 840 :LLERKKFMMPSTIGL :Sequence