[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAC35840.2 cele0 Y111B2A.11 "zinc-finger protein"
MATTSKAFRARALDSNRSMTVYWGHELPDLSECSVGNRAVTQMPSGMEKEEEQEKHLQEA
IAAQQASTSGIQLNHVIPTPKVDRVEDQRYHSTYHNKNKMHRSKYIKVHAWQALERDEPE
YDYDTEDEAWLSDHTHIDPRVLEKIFDTVESHSSETQIASEDSVINLHKSLDSSIVYEIY
EYWLSKRTSAATTSGCVGVGGLIPRVRTECRKDGQGVINPYVAFRRRAEKMQTRKNRKND
EDSYEKILKLVHDMSKAQQLFDMTARREKQKLALIDMESEILAKRMEMSDFGGSPSSFNE
ITEKIRAAATLEVVKPPLAEINGSDEVKKRKKPRRKIADKDLISKAWLKKNAESWNRPPS
LFGQHSGNVPTVTTKPVRESLANGRFAFKRRRGCVYRAALTVYNVPTAPATVPPVQTQAA
VASSSSSKSTDMVPSNMKFFETFVRDSQDSVSRSLGFVRRRMGRGGRVVFDRMPRNRDDN
DERTSTDPWAEYCVADSSRTFRARNSSLGTEEETDDLSPKSLYFARSNRFAFNDDETERE
WTSRCQQSSWRDTEVDDELKKRETTSEKFTETTTNGSTKTHTESDDSEVERMEVDDQVDE
AQITVSSSKDDGMNGNDKNEDEEDDDDDMDVDEHQTVVGVHQHQQQQHHQQKVRHQMNGG
GGGGGVVKLKPPLQELSPPLSGNGRADRAEPTPVPAKMCGTVSDSDDWREPSGSPSESNS
STEWGGYTPQEQHAVVVANAVAVAFKEKLMNGVDDDDDQQPSPARGARDHSIKDSMSTVT
LLERKKFMMPSTIGL
//