[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:Y37D8A.10"

            ""
SPCS2_CAEEL  "RecName: Full=Probable signal peptidase complex subunit 2;         EC=3.4.-.-;AltName: Full=Microsomal signal peptidase 25 kDa subunit;         Short=SPase 25 kDa subunit;"

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----1-1-------1-----------------------------------------1----------------------------------------------1-1-1--2121111111121111131181112111-1111111111-1-11-111-111111111111111--------------1-1-1------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTDEPVKVVNKWDGPTVKNALDEVVKKILNDKVGWTESHNLMNLRLLISFIGVAFSAFAC:Sequence :============================================================:BL:SWS|1->180|SPCS2_CAEEL|e-105|100.0|180/180 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->175|PF06703|8e-29|41.7|156/159|SPC25 61: . . . * . .: 120 :GYDYYEPFPKSKIVLAVCSVSYFICMGILQMYQWYVEKDCIYEATEVDGKQSRKWAWSSE:Sequence : ===============:RP:SCP|106->177|1t72A|4e-04|19.4|72/215|a.7.12.1 :============================================================:BL:SWS|1->180|SPCS2_CAEEL|e-105|100.0|180/180 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->175|PF06703|8e-29|41.7|156/159|SPC25 121: . . + . . .: 180 :IKAHDDKYTLSAEFKKEGRSGQGKITKSIGAYIDNDGEIIVPLVKKEVDDLYNRLIRSEQ:Sequence :========================================================= :RP:SCP|106->177|1t72A|4e-04|19.4|72/215|a.7.12.1 :============================================================:BL:SWS|1->180|SPCS2_CAEEL|e-105|100.0|180/180 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|17->175|PF06703|8e-29|41.7|156/159|SPC25