[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:Y54E2A.12"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----111-------1-1-11111111111111111111111111111-111111-111111111--1---1-1-------------11----1--1-------121-1--132222-111111111111261-2121111111111111111121112211112141211-1111--1------1----1---11111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHSSFSEPNSPLKEVLVDKWQTASCSDLGEEYVKPGPLARAKFNALRNKREAIDRFLKKH:Sequence : HHHHHHHHHTcc:Sec Str : =================:RP:SCP|44->206|1fkmA1|4e-04|23.5|136/194|a.69.2.1 : =====================:BL:SWS|40->356|TBC20_MOUSE|4e-41|36.7|283/402 61: . . . * . .: 120 :RKEDLSLYIDELRDFAISPGGLVDDEFRAVIWPVLSANLVQNDDLDDVSSSYDSDFESAQ:Sequence :ccc HHHHHHHHT TcccGGGHHHHHHHHHTcccccc :Sec Str : XXXXXXXXXXXXXXXXXX:SEG|103->121|ddlddvsssydsdfesaqs :============================================================:RP:SCP|44->206|1fkmA1|4e-04|23.5|136/194|a.69.2.1 :============================================================:BL:SWS|40->356|TBC20_MOUSE|4e-41|36.7|283/402 121: . . + . . .: 180 :SDFDEEPAYEESEELTLEDLKGHKEWNQVELDVHRTLSRFPPNISDTHRDVLQTELIPLI:Sequence : HHHHHHHHHHHHHHHccTTccHHHHH HHHHHHHHHHHTcTTccccGGGHHHHHH:Sec Str :X :SEG|103->121|ddlddvsssydsdfesaqs :============================================================:RP:SCP|44->206|1fkmA1|4e-04|23.5|136/194|a.69.2.1 :============================================================:BL:SWS|40->356|TBC20_MOUSE|4e-41|36.7|283/402 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|148->298|PF00566|1e-06|28.3|145/204|TBC 181: . * . . . .: 240 :VRVLSINPRFNYYQGFHDICLTVLLVCGEVDALPVCSNLAKNGSFNNYLLKTLEKSVVRE:Sequence :HHHHHccccGGGccGGGccHH HHHHHHHHHHHHHHHHHHT TGGGccTTcHHHHHH:Sec Str :========================== :RP:SCP|44->206|1fkmA1|4e-04|23.5|136/194|a.69.2.1 : ====:RP:SCP|237->353|1fkmA2|2e-07|15.5|116/128|a.69.2.1 :============================================================:BL:SWS|40->356|TBC20_MOUSE|4e-41|36.7|283/402 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|148->298|PF00566|1e-06|28.3|145/204|TBC 241: + . . . . *: 300 :LDLLYVILSRVDPSLEQVMRSVELGTMFGLSWPLTWFSHTLKQYQQIVRFFDVFLASSPL:Sequence :HHHHHHHHHHHcHHHHHHHHHTTccTHHHHHHHHTTTGGG ccHHHHHHHHHHHHHcccH:Sec Str :============================================================:RP:SCP|237->353|1fkmA2|2e-07|15.5|116/128|a.69.2.1 :============================================================:BL:SWS|40->356|TBC20_MOUSE|4e-41|36.7|283/402 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|148->298|PF00566|1e-06|28.3|145/204|TBC 301: . . . . + .: 360 :LPIYVSAAVVVFRRASILACEREMPFLHRLLTEMPHELPIDTIIKDSVYLSKLMPPCLLK:Sequence :HHHHHHHHHHHHTHHHHHTcHHHHHHHHccccTTccHHHHHHHHHHHHHH :Sec Str : XXXXXXXXXXXX :SEG|305->316|vsaavvvfrras :===================================================== :RP:SCP|237->353|1fkmA2|2e-07|15.5|116/128|a.69.2.1 :======================================================== :BL:SWS|40->356|TBC20_MOUSE|4e-41|36.7|283/402 361: . . . * . .: 420 :TKYTNEYRKIVSKPSKAAVKTIPRYALQFMFVAGTVGAAASFFFFKQIHPM :Sequence : :Sec Str