[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAA21685.2 cele0 Y54E2A.12 "7 transmembrane receptor (rhodopsin family)"
MHSSFSEPNSPLKEVLVDKWQTASCSDLGEEYVKPGPLARAKFNALRNKREAIDRFLKKH
RKEDLSLYIDELRDFAISPGGLVDDEFRAVIWPVLSANLVQNDDLDDVSSSYDSDFESAQ
SDFDEEPAYEESEELTLEDLKGHKEWNQVELDVHRTLSRFPPNISDTHRDVLQTELIPLI
VRVLSINPRFNYYQGFHDICLTVLLVCGEVDALPVCSNLAKNGSFNNYLLKTLEKSVVRE
LDLLYVILSRVDPSLEQVMRSVELGTMFGLSWPLTWFSHTLKQYQQIVRFFDVFLASSPL
LPIYVSAAVVVFRRASILACEREMPFLHRLLTEMPHELPIDTIIKDSVYLSKLMPPCLLK
TKYTNEYRKIVSKPSKAAVKTIPRYALQFMFVAGTVGAAASFFFFKQIHPM
//