[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cele0:ZK596.2"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --5---------------------2--------111-----------------------------------------------------------------------------------------------------11-----1--------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3-------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-----------------------------------------------------1-18----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-------------------------2- 3122754-F6534455542222233322222222222523434333125332523623444523334323663345636543333378-69956GB6333462DDG3726BFMDHMF8987DCDVW4N7p*J1NEU6AB5N59MA6C888E76RBEFBC7EAI9574O59G**982452L44345CFPK4K64224335 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MATICELVQLPVGSECGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLL:Sequence : cccccEEcccTGccccccEEEEEEEccEEEEEETTTEccEEEEEEEETTcccccH:Sec Str : ######################### :PROS|25->49|PS00107|PROTEIN_KINASE_ATP|PDOC00100| : ===========================================:RP:SCP|18->233|1nw1A|1e-13|10.7|206/365|d.144.1.8 : ===========================================:BL:SWS|18->305|TTBK1_MOUSE|7e-54|42.4|276/1308 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->245|PF00069|1e-13|33.7|202/256|Pkinase 61: . . . * . .: 120 :KMEVAVLLEVKKQKIVGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMG:Sequence :HHHHHHHHHTTTcTTcccEEccccEEEEEETTEEEEEEEcccccHHHHHHHTTETcccHH:Sec Str :============================================================:RP:SCP|18->233|1nw1A|1e-13|10.7|206/365|d.144.1.8 :============================================================:BL:SWS|18->305|TTBK1_MOUSE|7e-54|42.4|276/1308 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->245|PF00069|1e-13|33.7|202/256|Pkinase 121: . . + . . .: 180 :TAISVARQSLEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDG:Sequence :HHHHHHHHHHHHHHHHHHTTEEcccccGGGEEEccTTcTTTTcEEEcccTTcEEcccTTT:Sec Str : ############# :PROS|141->153|PS00108|PROTEIN_KINASE_ST|PDOC00100| :============================================================:RP:SCP|18->233|1nw1A|1e-13|10.7|206/365|d.144.1.8 :============================================================:BL:SWS|18->305|TTBK1_MOUSE|7e-54|42.4|276/1308 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->245|PF00069|1e-13|33.7|202/256|Pkinase 181: . * . . . .: 240 :TLRNPRARAGFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDV:Sequence :ccccccccccccccTTTccHHHHTTccccHHHHHHHHHHHHHHHHHcccTTTTcccccHH:Sec Str :===================================================== :RP:SCP|18->233|1nw1A|1e-13|10.7|206/365|d.144.1.8 :============================================================:BL:SWS|18->305|TTBK1_MOUSE|7e-54|42.4|276/1308 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->245|PF00069|1e-13|33.7|202/256|Pkinase 241: + . . . . *: 300 :GVFKKECKTTRLRCLFGGCPREFTEVFPILDKGKFFDAPEYTTIYELLEKAMVNTKSNEF:Sequence :HHHHHHHHHccHHHHTTTccHHHHHHHHHHHTccTTccccHHHHHHHHHHHHHHTTcccc:Sec Str :============================================================:BL:SWS|18->305|TTBK1_MOUSE|7e-54|42.4|276/1308 :$$$$$ :RP:PFM|21->245|PF00069|1e-13|33.7|202/256|Pkinase 301: . . . . + .: 360 :PYDWE :Sequence :ccTTT :Sec Str :===== :BL:SWS|18->305|TTBK1_MOUSE|7e-54|42.4|276/1308