[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF52967.1"

            "hypothetical protein"
            ""

OrgPattern -----------------------111111111-----------1111111111--------111---- 1111211111111111112-12111311111122221111212122222222222222222222221223222222221111111111222212222112222222222222222222222222211111111111111111111111111111111111111111111111111111111111111111112222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222322222234222222212122222222222221222222222111221122111121111111111113222222222222222222222222222222222-22223222222222222222222222222222222222222222222222222221111111111112222222222222111112222222222222222222222222222222232222222222222222222222221121222222222111222112121111111111111111111111122111111111111111111111111111222222222222222222222222222222221-2222211111122222222222222222-22122222222222222222222222222222222222222222222222221222222222222112222222222222222222222222212222222222222222222222222222222222222222222222222222222222222222222222222212222222222222221211112-22222222222222222221111111111122 22-1211141211121111111111111111111111111-111111111111111111111111111-111111111111-111111-12112111111111111115212223342212222221319F2-426122221223222122-13-422213-12121111343123222F2222252391533443222 ---11--------------1---------------111-1----------------------------------------------------------------------------------------------------------------------------------111--

Master   AminoSeq   


1: . . . . + .: 60 :MANTEHNYDASSITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSVDEAMAGHATK:Sequence : ccccGGGcccccTHHHHHHcHHHHHccccHHHHHHHHHHHHHHHHHHHHTTcccE:Sec Str : ======================================================:RP:SCP|7->175|1j6rA|6e-40|11.5|165/197|d.173.1.2 : ==========================================================:BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 : $$$$$$$$$$$$$$$:RP:PFM|46->99|PF04268|1e-04|38.9|54/147|SoxG 61: . . . * . .: 120 :VEVTLLEDGGVQVVDDGRGIPVDMHPSGAPTVQVVMTQLHAGGKFDSDSYAVSGGLHGVG:Sequence :EEEEEcTTccEEEEEccccccEEEEEcccHHHHHHTEEEEEEEEcccccccccccccccH:Sec Str : XXXXXXXXXX :SEG|68->77|dggvqvvddg :============================================================:RP:SCP|7->175|1j6rA|6e-40|11.5|165/197|d.173.1.2 :============================================================:BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|46->99|PF04268|1e-04|38.9|54/147|SoxG 121: . . + . . .: 180 :ISVVNALSTRVEADIKLHGKHWYQNFEKSVPDELIEGGNARGTGTTIRFWPDAEIFETTE:Sequence :HHHHHHTEEEEEEEEEETcccEEEEEETTEEccccccccccccEEEEEEEEcTTTccccc:Sec Str : XXXXX:SEG|176->185|fettefdfet :======================================================= :RP:SCP|7->175|1j6rA|6e-40|11.5|165/197|d.173.1.2 : ========================================================:RP:SCP|125->348|2j0nA1|5e-33|13.4|164/171|a.250.1.1 :============================================================:BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 181: . * . . . .: 240 :FDFETISRRLQEMAFLNKGLTITLTDNRATDEELELEALAEQGETATELSLDEIDNETEL:Sequence :ccHHHHHHHHHHHHHHcTTcEEEEEETTEEEEEE cETTHTTEEEc:Sec Str :XXXXX :SEG|176->185|fettefdfet : XXXXXXXXXXXXXXXXXXXXX :SEG|209->229|atdeelelealaeqgetatel :============================================================:RP:SCP|125->348|2j0nA1|5e-33|13.4|164/171|a.250.1.1 :============================================================:BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 241: + . . . . *: 300 :VEETTDAPKKPKKREKKKIFHYPNGLEDYVQYLNRSKTNIHPSIVSFEAKGDDHEVEVAM:Sequence :cEEEEccTHH HEEEcTTHHHHHHHHHHTTccccccccEEEEEEETTEEEEEEE:Sec Str : XXXXXXXXXXX :SEG|248->258|pkkpkkrekkk :============================================================:RP:SCP|125->348|2j0nA1|5e-33|13.4|164/171|a.250.1.1 :============================================================:BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|265->432|PF00204|8e-51|53.9|167/169|DNA_gyraseB 301: . . . . + .: 360 :QWNSSYKESVHTFANTINTREGGTHEEGFRSALTSLMNRYAREHKLLKEKEANLTGDDCR:Sequence :EEccccccEEEEEETTEEcTTccHHHHHHHHHHHHHHHHHHTccGcccGGGGGccHHHHT:Sec Str :================================================ :RP:SCP|125->348|2j0nA1|5e-33|13.4|164/171|a.250.1.1 : =====================:RP:SCP|340->652|1dc1A|7e-88|13.2|288/310|c.52.1.11 :============================================================:BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|265->432|PF00204|8e-51|53.9|167/169|DNA_gyraseB 361: . . . * . .: 420 :EGLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEHIGHWLEANPAEAKVIINKAV:Sequence :TTEEEEEEEEccGGGcccccTTccccTTHHHHHHHHHHHHHHHHHTTcTTHHHHHTTccc:Sec Str :============================================================:RP:SCP|340->652|1dc1A|7e-88|13.2|288/310|c.52.1.11 :============================================================:BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|265->432|PF00204|8e-51|53.9|167/169|DNA_gyraseB 421: . . + . . .: 480 :GSAQARLAARKARDLVRRKSATDLGGLPGKLADCRSKDPEKSELYIVEGDSAGGSAKSGR:Sequence :HHHHHHHHHcHHHHHHHHHHHHHHEcTTTTTTGGGHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : ######### :PROS|466->474|PS00177|TOPOISOMERASE_II|PDOC00160| :============================================================:RP:SCP|340->652|1dc1A|7e-88|13.2|288/310|c.52.1.11 :============================================================:BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 :$$$$$$$$$$$$ :RP:PFM|265->432|PF00204|8e-51|53.9|167/169|DNA_gyraseB : $$$$$$$$$$$$$$$$$$$:RP:PFM|462->564|PF01751|1e-14|45.0|100/110|Toprim 481: . * . . . .: 540 :DSMFQAILPLRGKILNVEKARLDKVLKNAEVQAIITALGTGIHDEFDINKLRYHKIVLMA:Sequence :HHHHHHHHHHHEEEEETTcTTcccEEEcccccTTGGGGEEEEEEEEEEEEEEEEEEETTT:Sec Str :============================================================:RP:SCP|340->652|1dc1A|7e-88|13.2|288/310|c.52.1.11 :============================================================:BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|462->564|PF01751|1e-14|45.0|100/110|Toprim 541: + . . . . *: 600 :DADVDGQHIATLLLTLLFRFMPDLVAEGHVYLAQPPLYKLKWQRGEPGFAYSDEERDEQL:Sequence :TEEEEEEEEEcccccGGGEEEEEEEEccccHHHHHHHHHHHHHHHHHEEHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|340->652|1dc1A|7e-88|13.2|288/310|c.52.1.11 :============================================================:BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|462->564|PF01751|1e-14|45.0|100/110|Toprim 601: . . . . + .: 660 :NEGLAAGRKINKDDGIQRYKGLGEMNASELWETTMDPTVRILRRVDITDAQRADELFSIL:Sequence :cHHHHHHccEEEEEEccccHHHHHHHHHHHHHTcccEEEETTcHHHHHHHHHHHHcccTT:Sec Str :==================================================== :RP:SCP|340->652|1dc1A|7e-88|13.2|288/310|c.52.1.11 :============================================================:BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|612->672|PF00986|2e-17|62.3|61/65|DNA_gyraseB_C 661: . . . * . .: 720 :MGDDVVARRSFITRNAKDVRFLDI :Sequence :TcccHHHHHHHHHHHHTTcHHHHH :Sec Str :======================== :BL:SWS|3->684|GYRB_MYCSM|0.0|67.9|666/675 :$$$$$$$$$$$$ :RP:PFM|612->672|PF00986|2e-17|62.3|61/65|DNA_gyraseB_C