[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF52976.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----11----1---2------1---7------21112-561---1-1-----7221----11----1311------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-11--------------1-----11-1-----------------------------------------------------------------1-------1111-12----111-------21--------------------1------------------------------------------------------------------------------------------------------------------------------1---1-------------------------------1-11-------------------------------------------1-------------1-----------------------------------2--1------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MYGLFGFSLSAAIAAWTGVAIPWWIVGLVGWVFVALMGVSNVELSAKVLGVLVALEFLVA:Sequence : XXX:SEG|58->69|lvaivvmivali 61: . . . * . .: 120 :IVVMIVALIHSPEGISTATLHAEDFFVPGIGVLLAFSIAAFMGFESGAIYSEETKDPSKT:Sequence :XXXXXXXXX :SEG|58->69|lvaivvmivali : ==================================================:BL:SWS|71->227|CYCA_ECOLI|4e-09|31.6|152/470 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|85->225|PF00324|3e-07|33.8|139/429|AA_permease 121: . . + . . .: 180 :VSRATYIAVGIIAIFYAASTWALAMGVGPSAIIDESRIYGPDLVFVWLASFSPALSNVAH:Sequence :============================================================:BL:SWS|71->227|CYCA_ECOLI|4e-09|31.6|152/470 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|85->225|PF00324|3e-07|33.8|139/429|AA_permease 181: . * . . . .: 240 :LLFVTSILAALLAFHNAAARYFFALGRSKVIPSVFGKLGKNGAPIGGSIAQSVVGLVVVI:Sequence : XXXXXXXXXXXX :SEG|188->199|laallafhnaaa : XXXXXXXXXXXX:SEG|229->247|iaqsvvglvvvivfaigga :=============================================== :BL:SWS|71->227|CYCA_ECOLI|4e-09|31.6|152/470 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|85->225|PF00324|3e-07|33.8|139/429|AA_permease 241: + . . . . *: 300 :VFAIGGANSTLGELFPVTTLFTWFSTAAAFGLVFLMAITSVAVLFWFRRNHHGYGVFTRV:Sequence :XXXXXXX :SEG|229->247|iaqsvvglvvvivfaigga 301: . . . . + .: 360 :IAPGAAALFLVVIAVLILMNFDIMIGEESPRAMIFIMPGIIIGTGVLGALWSLRFDREID:Sequence : XXXXXXXXXXXXXX :SEG|305->318|aaalflvviavlil 361: . . . * . .: 420 :VNAIPIAETAVVDESGTGSNAGSNAEDTQASSPAHTTI :Sequence