[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53009.1"

            "hypothetical protein"
            ""

OrgPattern ------------------------11111111111------2-2211111111--------1----22 2232321211111111112-11111211111111113111111112111111111111--1111321132211111111------1-------------123322-2121--------------1---------1-222221112-1--111-111111111111----11111-11111111333-----111111111111111111211111111-11221111111133111111111111111111112111111111111111111111-11122212221212222222222212222222222221222222222-211211111112122111122211111221211111-1---------221-3-----------111--1-1--1-------------------1--------------------1---------------------1--1---------11-------------------------111111111111222211-2222222111111122222-11111---11221221222-------1112221-1-1-1111----1111-221-2222242112111111111111111111122-12111111-11111121111-11111111-111---21---------11111111111111-11-1111111111111111111111211111111111111111111111111111-111111111111---2-----11111-1-21111-2111111--111111121111111112111122221-11----------111------22111111111111111111--1222222---1-111112------------------------------------22 75669AB-M8A2ACDABA9899999A78888786865876877876A89989996997998887766556556566655665565598-BHCB9CACBBBA98DCF28TCcOKKHNJ76EA7E9RO7lAo*Z1NPi8B87I9AHH9D9AEF9AM7GEFFFJOGEHA6DAEMHGGD3IJH*EEFDFTFPYBKGFFFDEAQ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGHVVGISLDVVMMGVMTSKTATAILHTNRGDITIDLFGNHAPETVANFVGLAQGTKEYQ:Sequence : ccccEEHHHHHHccEEEETTEEEEEEEEEEcTTTcHHHHHHHHHHHHTTTccc:Sec Str : =====================================:RP:SCP|24->188|1a33A|3e-35|37.7|159/174|b.62.1.1 : ========================================:BL:SWS|21->189|PPIA_MYCTU|2e-67|79.9|169/182 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->185|PF00160|6e-30|52.1|142/151|Pro_isomerase 61: . . . * . .: 120 :AQNAQGDSEGPFYNGSVFHRVIDGFMIQGGDPTGTGRGGPGYTFADEFHPELRFDRAYLL:Sequence :ccTccccccccccTTccccEEETTTEEEEccTTTccccccccTTccccccccccccccEE:Sec Str : XXXXXXXXXXXXX :SEG|89->101|ggdptgtgrggpg : ################## :PROS|73->90|PS00170|CSA_PPIASE_1|PDOC00154| :============================================================:RP:SCP|24->188|1a33A|3e-35|37.7|159/174|b.62.1.1 :============================================================:BL:SWS|21->189|PPIA_MYCTU|2e-67|79.9|169/182 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->185|PF00160|6e-30|52.1|142/151|Pro_isomerase 121: . . + . . .: 180 :AMANAGPGTNGSQFFITVTPTPHLNNAHTIFGEVTDAESQKVVDAIATTATDRYDRPADA:Sequence :EEccccTTcccccEEEEccccGGGTTTccEEEEEEGHEcHHHHHHHHTccccTTcccccc:Sec Str :============================================================:RP:SCP|24->188|1a33A|3e-35|37.7|159/174|b.62.1.1 :============================================================:BL:SWS|21->189|PPIA_MYCTU|2e-67|79.9|169/182 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->185|PF00160|6e-30|52.1|142/151|Pro_isomerase 181: . * . . . .: 240 :VVIESVEITA :Sequence :EEEEEEEEEE :Sec Str :======== :RP:SCP|24->188|1a33A|3e-35|37.7|159/174|b.62.1.1 :========= :BL:SWS|21->189|PPIA_MYCTU|2e-67|79.9|169/182 :$$$$$ :RP:PFM|26->185|PF00160|6e-30|52.1|142/151|Pro_isomerase