[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53115.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------1-3517-4--211-12---211111-2636-388-134---4--8F-1-12----14---D2-------A7-----1------2--------------------------------------------------------------8-------------1-----------------------------------1-------3-----------1B---------5---6-2-21---22----3--N4sM3J-871197613-1343F---1-L8-----12241124152-B21C-1132151-11A8-----------------1---------E--S-----------------392----1-1111-----------1-----------------1--1E----------1111-13-133------1--2--1-------------------------------------1------------2-------3-1-6----------1--1--1i2--1D-22-14--212-13--24---------E6A7---2--2----------------------------2-------------------------------5--------6-R1228--2---------------2--------------33413---1--343--1---331111311----1-26-------------------------------------------55--4---1-----6----------1-1---8---------------2-----13---k---------A--1------1-81------1ffi--------22------------3------------3-------6-2----------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAKIGRPGLPQDQRQKVWDLWKTGSSISDISRDVGSPPGSIFSILLPRGGIYLPAQKHHP:Sequence : :Sec Str : =:RP:SCP|60->101|1tc3C|6e-05|19.0|42/51|a.4.1.2 : =================================================:BL:SWS|12->379|INSI_ECOLI|2e-87|45.7|368/383 61: . . . * . .: 120 :GTLTLAEREEISRGLSVGLSYRAIARLTGRSASTISREVTRNRGRTAYRAIDADDRSWRQ:Sequence : HHHHHHHHTTcccHHHHHHHHTccHHHHHHcEEETTTEEEcccccccccHHHH:Sec Str :========================================= :RP:SCP|60->101|1tc3C|6e-05|19.0|42/51|a.4.1.2 :============================================================:BL:SWS|12->379|INSI_ECOLI|2e-87|45.7|368/383 121: . . + . . .: 180 :ARRPQRCKLAKNPVLRGYVAARLREDWSPEQIAGRLKITYACTSRMQISHESIYKSLFIQ:Sequence :HHTcccccEEEccEEc cHHHHHHHHGGGccTTcEEEEcEEcccccccTcEEEEEEEE :Sec Str :============================================================:BL:SWS|12->379|INSI_ECOLI|2e-87|45.7|368/383 181: . * . . . .: 240 :SRGVLPKDLQKHLRSRRPIRKARSNTTSGQWRSQIKDAVSISKRPKEAEARVQVGHWEGD:Sequence : TEEEEE:Sec Str :============================================================:BL:SWS|12->379|INSI_ECOLI|2e-87|45.7|368/383 241: + . . . . *: 300 :LVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLTWDRGME:Sequence :EEEETTEEEEEEEEETTTccEEEEEEccccHHHHHHHHHHHHHHccccEEEcEcccTTTT:Sec Str :============================================================:BL:SWS|12->379|INSI_ECOLI|2e-87|45.7|368/383 301: . . . . + .: 360 :LAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDLDQVADK:Sequence :cHHHHHHHHHHTcEEEccHHHHHHHHHHHHHHHHTTcccHccHGGGcccHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|12->379|INSI_ECOLI|2e-87|45.7|368/383 361: . . . * . .: 420 :LNNRPRKVLGFRTPAEQYEALLR :Sequence :HHHcccTTTTcccHHH :Sec Str :=================== :BL:SWS|12->379|INSI_ECOLI|2e-87|45.7|368/383