[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53177.1"

            "hypothetical protein"
PAND_CORGL  "RecName: Full=Aspartate 1-decarboxylase;         EC=4.1.1.11;AltName: Full=Aspartate alpha-decarboxylase;Contains:  RecName: Full=Aspartate 1-decarboxylase beta chain;Contains:  RecName: Full=Aspartate 1-decarboxylase alpha chain;Flags: Precursor;"

OrgPattern ---------------------11-----1--------------------------------------- ----1--11111-111111-111131111111111111111121--1-111-211111--111-1111111---------1--1111111111111---11111111111---------------11111111111-----1111-111-111----------11-21111------------11111---211111111111111111111111111111111111111121-11111111111111111111-----------1---------------------------------------------------------1--111111211-111-111-----11---111111211--1111-11---111111-----111---------------------------1---2---11---1------1111-----------------------11------------------------------------1111-1111111111111111111111111-1--111111-1111212-1111111111111111-----11---111-1-1----1-1---111111111111111111111-1111111111111111--1--1----1----------------------1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111----11111111111-11---------------1111111111111111---------1---1111111111--------------1111111111111111--111111------------------------------------11-1111111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVI:Sequence :cEEEcccEEEEEEEcccEEcccccEEEEEHHHHHHTTccccccEEEEETTTccEEEEcEE:Sec Str :============================================================:RP:SCP|1->120|1uhd.1|2e-23|50.0|118/119|b.52.2.1 :============================================================:BL:SWS|1->136|PAND_CORGL|4e-73|100.0|136/136 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->114|PF02261|7e-38|65.8|114/116|Asp_decarbox 61: . . . * . .: 120 :VGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRIVALGND:Sequence :EEcTTTTcEEEEccTTTTccTTcEEEEEEccEEEHHHHHccccEEEEccTTccEEEEE :Sec Str :============================================================:RP:SCP|1->120|1uhd.1|2e-23|50.0|118/119|b.52.2.1 :============================================================:BL:SWS|1->136|PAND_CORGL|4e-73|100.0|136/136 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->114|PF02261|7e-38|65.8|114/116|Asp_decarbox 121: . . + . . .: 180 :LAEALPGSGLLTSRSI :Sequence : :Sec Str :================ :BL:SWS|1->136|PAND_CORGL|4e-73|100.0|136/136