[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53239.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKTFNPTMIAGLIGVLYFVLLTLIFSIQDMELAAEIAFGIVTIVGLIAVWDNFRDRNNST:Sequence : =========================:BL:SWS|36->134|SSTT_ACIBT|1e-04|30.9|97/400 61: . . . * . .: 120 :WKTWTGLVGGLLIAVPGICLLVGNLVLLAVDGNPSTMVNTLLSVAGIGAIFLLPIGIIMC:Sequence :============================================================:BL:SWS|36->134|SSTT_ACIBT|1e-04|30.9|97/400 121: . . + . . .: 180 :LIAGFNRFYAALKV :Sequence :============== :BL:SWS|36->134|SSTT_ACIBT|1e-04|30.9|97/400