[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF53239.1 cglu2 BAF53239.1 "hypothetical protein"
MKTFNPTMIAGLIGVLYFVLLTLIFSIQDMELAAEIAFGIVTIVGLIAVWDNFRDRNNST
WKTWTGLVGGLLIAVPGICLLVGNLVLLAVDGNPSTMVNTLLSVAGIGAIFLLPIGIIMC
LIAGFNRFYAALKV
//