[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53342.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTGLLVVIIPLLLMLFAFAMERIESSFLHSNTPQSTEVKLAKDAIGAENLNDDDVQEASA:Sequence : XXXXXXXXXXXX :SEG|4->15|llvviiplllml 61: . . . * . .: 120 :A :Sequence