[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF53342.1 cglu2 BAF53342.1 "hypothetical protein"
MTGLLVVIIPLLLMLFAFAMERIESSFLHSNTPQSTEVKLAKDAIGAENLNDDDVQEASA
A
//