[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53395.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------11111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTARVKMISMRKTIITMLATTAIAFSAISPVQAQTVDTDTDASVSSELSSGTSSGSSEDS:Sequence : XXXXXXXXXXXX :SEG|13->24|tiitmlattaia : XXXXXXXXXXXXXXXXXX:SEG|43->66|svsselssgtssgssedsedsdls 61: . . . * . .: 120 :EDSDLSNRDIIFGVAAIAAVGGLIAGGVHWAVQQRMIPNPLPGIIPNPPALAPQAPAPAP:Sequence :XXXXXX :SEG|43->66|svsselssgtssgssedsedsdls : XXXXXXXXXXXXXXXXXXX :SEG|70->88|iifgvaaiaavggliaggv : XXXXXXXXXXXXXXXXXXXXXXX:SEG|98->144|pnplpgiipnppalapqapapapapapapqavapqavapapapapvq 121: . . + . . .: 180 :APAPAPQAVAPQAVAPAPAPAPVQTNRTYKNCTEVWNVLGRSIRQGEPGYGTHLDRDRDG:Sequence :XXXXXXXXXXXXXXXXXXXXXXXX :SEG|98->144|pnplpgiipnppalapqapapapapapapqavapqavapapapapvq : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|149->184|PF05901|4e-06|50.0|36/37|Excalibur 181: . * . . . .: 240 :IGCESRPR :Sequence :$$$$ :RP:PFM|149->184|PF05901|4e-06|50.0|36/37|Excalibur