[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53422.1"

            "hypothetical protein"
            ""

OrgPattern --------------------------------11---------------------------------- ----11-111111111211-14113111111122431222111121112111211111--113111111111---11111211-1-----------------------1---------------------------111-----11-11-11111---------1111111-------------11--11-221111111211112121111111111212222111111131-111-1111111111111111----------------------------1-------------------------------11---111--22121112221121-133-1113--111111-5412-11211111----11-1--1-------11221111111----------1-211-112-----------------11-21---------------------1----------------------------------1------------------------------------------------------------11---------1----1--------1----1-1---11121-1--1-1-----------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------111111111-------------------------------------11-------------------------------------1111-------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSNSECHTHGYIEEKQRYLARLKRIEGQTRGIHRMIDEEQYCIDILTQISAVNSALKNVA:Sequence : HHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHH:Sec Str : ====================================================:BL:SWS|9->100|CSOR_BACSU|2e-20|48.9|90/101 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->90|PF02583|1e-16|59.7|77/84|DUF156 61: . . . * . .: 120 :FGLLDDHLAHCVKEAADLGGDELDAKLKEVSDAIARFSKA :Sequence :HHHHHHHHHTTTTTcccTTHHH HHHHHHHHTT :Sec Str :======================================== :BL:SWS|9->100|CSOR_BACSU|2e-20|48.9|90/101 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|12->90|PF02583|1e-16|59.7|77/84|DUF156