[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53444.1"

            "hypothetical protein"
            ""

OrgPattern ------11-------1----------------1----------11--1--211--------------- 1111121222222222222-2222222222221222222211121-121---222222--2221333332-2111-11--11-1111111-2----1--1---1-21221---------------2222222222211111---1-11111111111111111111111111111111111111-11----11-111111111111111-1----111---1-11-------11--------------11111--2-11-2---112211--1-1-----------------------------------------------1-111-------------11------11----1-11111-1---111----1--1221-11-12------111--122222222121--------111--122111-111-----1-2-2----11-22222222-1121111------------------------------2121-1111111111111111111-11111-1111111-1111-11--11----111-1-11111111111111111--------------11121121-1-2122--111---------1-------112111122221112112111111--111111--11----1111------22222222222221222-2222222222222222222222222222222222222222222222222221-211221122222-------------111111111111-11111111111111-1111111111211111111111----------112222222222211111111111111--1-111111----------------------------------------------2-- -------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------3--2-1-------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGSNTVHLVAVDARPGGHPTPMSNWRTPLRLVELLDDSGAISEKGINKLTSAVGEAADLA:Sequence :EccccEEEEEEEEEETTEEEEEEEEEEcccTTTTHHHHccccHHHHHHHHHHHHHHHHHH:Sec Str : ===========================================================:RP:SCP|2->114|1u6zA2|4e-11|23.2|112/124|c.55.1.8 :============================================================:BL:SWS|1->298|Y507_MYCBO|e-113|68.5|298/344 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->293|PF02541|1e-34|41.1|258/283|Ppx-GppA 61: . . . * . .: 120 :KTLGCAELMPFATSAVRSATNSEAVLDHVEEETGVRLSILSGEDEARQTFLAVRRWYGWS:Sequence :HTccccEEEEEEcHHHHHcTTHHHHHHHHHHHHccccEEccHHHHHHHHHHHHHHccccT:Sec Str :====================================================== :RP:SCP|2->114|1u6zA2|4e-11|23.2|112/124|c.55.1.8 :============================================================:BL:SWS|1->298|Y507_MYCBO|e-113|68.5|298/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->293|PF02541|1e-34|41.1|258/283|Ppx-GppA 121: . . + . . .: 180 :AGRITNLDIGGGSLELSSGTDESPDLAFSLDLGAGRLTHNWFDTDPPARKKINLLRDYID:Sequence :cccEEEEEEccccEEEEEccccccccTTcccEEEEcccHHHHHcccccHHHHHHHHHHHH:Sec Str : ===========================================================:RP:SCP|122->299|1t6cA2|1e-39|25.0|172/180|c.55.1.8 :============================================================:BL:SWS|1->298|Y507_MYCBO|e-113|68.5|298/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->293|PF02541|1e-34|41.1|258/283|Ppx-GppA 181: . * . . . .: 240 :AELAEPARQMRTLGPARLAVGTSKTFRTLARLTGAAPSSAGPHVTRTLTAPGLRQLIAFI:Sequence :HHHHHHHHHccGGGccEEEEEEcHHHHHHHHHcTccccccGGGTTcEEEHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|122->299|1t6cA2|1e-39|25.0|172/180|c.55.1.8 :============================================================:BL:SWS|1->298|Y507_MYCBO|e-113|68.5|298/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->293|PF02541|1e-34|41.1|258/283|Ppx-GppA 241: + . . . . *: 300 :SRMTAADRAELEGISSDRSHQIVAGALVAEAAMRALDIDKVEICPWALREGVILTRIDKG:Sequence :HHTcHHHHHTcTTccGGGTTTHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHH:Sec Str :=========================================================== :RP:SCP|122->299|1t6cA2|1e-39|25.0|172/180|c.55.1.8 :========================================================== :BL:SWS|1->298|Y507_MYCBO|e-113|68.5|298/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|29->293|PF02541|1e-34|41.1|258/283|Ppx-GppA 301: . . . . + .: 360 :LE :Sequence :HT :Sec Str