[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF53444.1 cglu2 BAF53444.1 "hypothetical protein"
MGSNTVHLVAVDARPGGHPTPMSNWRTPLRLVELLDDSGAISEKGINKLTSAVGEAADLA
KTLGCAELMPFATSAVRSATNSEAVLDHVEEETGVRLSILSGEDEARQTFLAVRRWYGWS
AGRITNLDIGGGSLELSSGTDESPDLAFSLDLGAGRLTHNWFDTDPPARKKINLLRDYID
AELAEPARQMRTLGPARLAVGTSKTFRTLARLTGAAPSSAGPHVTRTLTAPGLRQLIAFI
SRMTAADRAELEGISSDRSHQIVAGALVAEAAMRALDIDKVEICPWALREGVILTRIDKG
LE
//